(data stored in ACNUC7421 zone)

EMBL: CP002116.PE167

CP002116.PE167       Location/Qualifiers
FT   CDS             175463..175849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0170"
FT                   /product="Domain of unknown function DUF2023"
FT                   /note="InterPro IPR018594; KEGG: bfs:BF2690 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF2023; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2023)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79327"
FT                   /db_xref="InterPro:IPR018594"
FT                   /db_xref="InterPro:IPR036780"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I3"
FT                   /protein_id="ADK79327.1"
FT                   /translation="MKVLAHHIYEYKKGLRSLVLHTLDASYEAEAVRRLERNNISYLIR
FT                   RVNKRKINIFFGNKACVHVVTSFGDKPLNAFTPEEDFILGIMLGYNRTEQCKRYLARKE
FT                   IFEIEAETARDLSFLPSGSLEKTG"
     MKVLAHHIYE YKKGLRSLVL HTLDASYEAE AVRRLERNNI SYLIRRVNKR KINIFFGNKA        60
     CVHVVTSFGD KPLNAFTPEE DFILGIMLGY NRTEQCKRYL ARKEIFEIEA ETARDLSFLP       120
     SGSLEKTG                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page