(data stored in ACNUC7421 zone)

EMBL: CP002116.PE17

CP002116.PE17        Location/Qualifiers
FT   CDS             complement(14170..14577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0017"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR002579; KEGG: bpt:Bpet1710 methionine sulfoxide
FT                   reductase B; PFAM: Methionine sulfoxide reductase B; PRIAM:
FT                   Peptide-methionine (R)-S-oxide reductase; SPTR: Peptide
FT                   methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: SelR domain;
FT                   TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79177"
FT                   /db_xref="GOA:E1R6P5"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P5"
FT                   /protein_id="ADK79177.1"
FT                   /translation="MESSSKMPHGESEWRDKLGPERYYVCRMKGTEAPFSGKLWDEHRK
FT                   GTYHCVGCGTPLFRSETKYDSGSGWPSFMDLIDQKRVERRTDSSHGMIRTELLCARCGC
FT                   HLGHLFEDGPQPTGLRYCINSVSLKFIAATS"
     MESSSKMPHG ESEWRDKLGP ERYYVCRMKG TEAPFSGKLW DEHRKGTYHC VGCGTPLFRS        60
     ETKYDSGSGW PSFMDLIDQK RVERRTDSSH GMIRTELLCA RCGCHLGHLF EDGPQPTGLR       120
     YCINSVSLKF IAATS                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page