(data stored in ACNUC7421 zone)

EMBL: CP002116.PE170

CP002116.PE170       Location/Qualifiers
FT   CDS             complement(177237..178136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0173"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="COGs: COG4822 Cobalamin biosynthesis protein CbiK
FT                   Co2+ chelatase; InterPro IPR010388:IPR019758; KEGG:
FT                   ctc:CTC00743 anaerobic cobalt chelatase CbiK; PFAM:
FT                   anaerobic cobalt chelatase; PRIAM: Sirohydrochlorin
FT                   cobaltochelatase; SPTR: Anaerobic cobalt chelatase cbiK;
FT                   PFAM: Cobalt chelatase (CbiK)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79330"
FT                   /db_xref="GOA:E1R8I6"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I6"
FT                   /protein_id="ADK79330.1"
FT                   /translation="MKSKSMRKVACMALALAGSLMLAACASTGGEKLTMNTNGKKGILV
FT                   ISFGTSYPETRAVTIDACEQKIAEAFPEYEVRRAFTSHIIIGILDKRDGIHVDAPAEAL
FT                   EKMYKEGFSEVLIQPLHIIPGEEYTGEVLAVARRYSGKFEKIAIGSPILSTTENYWKAV
FT                   DAVSAQLPSLGTGEAVVLMGHGTEHPANCAYAAFQYMLARKGLPVYVGTVEGYPALDDV
FT                   IDLLHRDHISKVTLMPFMVVAGDHATNDMAGDEDDSWKSILTKEGFTVDVYLHGLGENS
FT                   IIQNMYIDNLHSAEVINE"
     MKSKSMRKVA CMALALAGSL MLAACASTGG EKLTMNTNGK KGILVISFGT SYPETRAVTI        60
     DACEQKIAEA FPEYEVRRAF TSHIIIGILD KRDGIHVDAP AEALEKMYKE GFSEVLIQPL       120
     HIIPGEEYTG EVLAVARRYS GKFEKIAIGS PILSTTENYW KAVDAVSAQL PSLGTGEAVV       180
     LMGHGTEHPA NCAYAAFQYM LARKGLPVYV GTVEGYPALD DVIDLLHRDH ISKVTLMPFM       240
     VVAGDHATND MAGDEDDSWK SILTKEGFTV DVYLHGLGEN SIIQNMYIDN LHSAEVINE        299
//

If you have problems or comments...

PBIL Back to PBIL home page