(data stored in ACNUC7421 zone)

EMBL: CP002116.PE171

CP002116.PE171       Location/Qualifiers
FT   CDS             complement(178164..180140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0174"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4771 Outer membrane receptor for
FT                   ferrienterochelin and colicins; InterPro
FT                   IPR012910:IPR000531; KEGG: cts:Ctha_2253 TonB-dependent
FT                   receptor; PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; SPTR: TonB-dependent receptor; PFAM:
FT                   TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79331"
FT                   /db_xref="GOA:E1R8I7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I7"
FT                   /protein_id="ADK79331.1"
FT                   /translation="MAMTRQLLPVVLLIAGAFAWPPALSAQQQEGKPEDEAAEAQAETI
FT                   EEQTEEADALPVLNIVVAGTRTEKEQKDSPIQTEVITEDQIEASGSDTLEGVLGETGLQ
FT                   FAETGMGSHVQMQGMDGERILFLIDGRRVSGRVASNIVANTIAMDNVERIEIIRGPQSA
FT                   LYGSEAIGGVINIITKEPDYELSGDYQVTTRALLPISESSDPAYTSLANKQSGLAHLNL
FT                   PIGAFANRLTLSAEHAFPYLDDEDQSLYPGATRADAGLDSDIVLSSGGTLAFGSAYSFH
FT                   RQKENISSGGAFDRIDTQRLNSYIAYDVTTEKKGFLKANLYHNYFQRDKSQYSSILDEW
FT                   NDSGSEYQHYLSGDLQYTQPLGDQNELTMIGSYGYDRLKKYNIGDYAVHQRHTFSLVLQ
FT                   DEQYKKDSYSLLAGLRSEYSNDYGIFFAPKLSGMYVPRPGIRILPSVGLGYRAPSFLEL
FT                   YLDSAGNIYHKYGNPDLDPERSVSFNLGVDWTRENVTLQFAGYHSELSDEIVYDYTDRA
FT                   DDDGRQVIIKENLDRSSRSGFDLSLNWNVLSDLSMTARYGYLFAYDRSAGEELDLVPSH
FT                   TGGASVHYLLKPLALKAKFSTSVTGPHERSEHTLVTFDVYLEKSLKDNFELFGGVDNIT
FT                   GVQDDFSDLLAGPVLYLGIRGSF"
     MAMTRQLLPV VLLIAGAFAW PPALSAQQQE GKPEDEAAEA QAETIEEQTE EADALPVLNI        60
     VVAGTRTEKE QKDSPIQTEV ITEDQIEASG SDTLEGVLGE TGLQFAETGM GSHVQMQGMD       120
     GERILFLIDG RRVSGRVASN IVANTIAMDN VERIEIIRGP QSALYGSEAI GGVINIITKE       180
     PDYELSGDYQ VTTRALLPIS ESSDPAYTSL ANKQSGLAHL NLPIGAFANR LTLSAEHAFP       240
     YLDDEDQSLY PGATRADAGL DSDIVLSSGG TLAFGSAYSF HRQKENISSG GAFDRIDTQR       300
     LNSYIAYDVT TEKKGFLKAN LYHNYFQRDK SQYSSILDEW NDSGSEYQHY LSGDLQYTQP       360
     LGDQNELTMI GSYGYDRLKK YNIGDYAVHQ RHTFSLVLQD EQYKKDSYSL LAGLRSEYSN       420
     DYGIFFAPKL SGMYVPRPGI RILPSVGLGY RAPSFLELYL DSAGNIYHKY GNPDLDPERS       480
     VSFNLGVDWT RENVTLQFAG YHSELSDEIV YDYTDRADDD GRQVIIKENL DRSSRSGFDL       540
     SLNWNVLSDL SMTARYGYLF AYDRSAGEEL DLVPSHTGGA SVHYLLKPLA LKAKFSTSVT       600
     GPHERSEHTL VTFDVYLEKS LKDNFELFGG VDNITGVQDD FSDLLAGPVL YLGIRGSF         658
//

If you have problems or comments...

PBIL Back to PBIL home page