(data stored in ACNUC7421 zone)

EMBL: CP002116.PE172

CP002116.PE172       Location/Qualifiers
FT   CDS             complement(180140..180976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kko:Kkor_2439 Na-Ca exchanger/integrin-beta4;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79332"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I8"
FT                   /protein_id="ADK79332.1"
FT                   /translation="MRKHVYTKNVGKAITPFLVILLFFAGCDLNSSGSSDSDGDTITYE
FT                   GKRNKPSDTWIYTYLFIDLEDPENPVEATGGDDLSTITEGSNTNWEIMITAQKEILTNS
FT                   GVTATSLSSSGQGGVVYAQTSNFDQSISITEAQALFADDSNDYSNDGKDYSYYGKYKVD
FT                   SSDPSEPTTGNAISYPGYAYNSSYPQDPQRDGQAPSTAWAFGEVGAHVDVNFGLGRAYA
FT                   EWERMSPNFSNFTNNVYIVRGGDGSSYYKLQILDAEYLSDSTNRTYIYKVKTAKIQ"
     MRKHVYTKNV GKAITPFLVI LLFFAGCDLN SSGSSDSDGD TITYEGKRNK PSDTWIYTYL        60
     FIDLEDPENP VEATGGDDLS TITEGSNTNW EIMITAQKEI LTNSGVTATS LSSSGQGGVV       120
     YAQTSNFDQS ISITEAQALF ADDSNDYSND GKDYSYYGKY KVDSSDPSEP TTGNAISYPG       180
     YAYNSSYPQD PQRDGQAPST AWAFGEVGAH VDVNFGLGRA YAEWERMSPN FSNFTNNVYI       240
     VRGGDGSSYY KLQILDAEYL SDSTNRTYIY KVKTAKIQ                               278
//

If you have problems or comments...

PBIL Back to PBIL home page