(data stored in ACNUC7421 zone)

EMBL: CP002116.PE175

CP002116.PE175       Location/Qualifiers
FT   CDS             complement(183738..184700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0178"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: det:DET0688 cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB; SPTR: Cobalamin biosynthesis protein CobD;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis protein
FT                   CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79335"
FT                   /db_xref="GOA:E1R8J1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J1"
FT                   /protein_id="ADK79335.1"
FT                   /translation="MNLCLPILAGALLYDLLWGDPPNRFHPVAWMGSLISRLWQHRPKQ
FT                   GKWLLFSYGALMTICGALLFSLPLLLLNRIPILPRLVLSIVFLKMSFSLTTLLRTGDKI
FT                   ARALEAGDLASARKLTAFHLVSRNTSELEESELCGAVVESLAENLTDSFTSPLLYYLLA
FT                   GLPGAFAFRYINTSDAMIGYRTGDFEFGGKWAARCDDLLNFIPARVTALLIILAGSIIP
FT                   IRSAPGEGNGAGRKRSLASLFAWQNATESPNAGWTMGAAAAILGLRLEKRGHYVINSTG
FT                   RLPKPADIRRCIRLVRRSALLFLLLLAGILACTGVILGS"
     MNLCLPILAG ALLYDLLWGD PPNRFHPVAW MGSLISRLWQ HRPKQGKWLL FSYGALMTIC        60
     GALLFSLPLL LLNRIPILPR LVLSIVFLKM SFSLTTLLRT GDKIARALEA GDLASARKLT       120
     AFHLVSRNTS ELEESELCGA VVESLAENLT DSFTSPLLYY LLAGLPGAFA FRYINTSDAM       180
     IGYRTGDFEF GGKWAARCDD LLNFIPARVT ALLIILAGSI IPIRSAPGEG NGAGRKRSLA       240
     SLFAWQNATE SPNAGWTMGA AAAILGLRLE KRGHYVINST GRLPKPADIR RCIRLVRRSA       300
     LLFLLLLAGI LACTGVILGS                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page