(data stored in ACNUC7421 zone)

EMBL: CP002116.PE176

CP002116.PE176       Location/Qualifiers
FT   CDS             complement(184697..186169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0179"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459:IPR002586:IPR011698:IPR017929; KEGG:
FT                   deg:DehalGT_0781 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; SPTR: Cobyric acid
FT                   synthase CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79336"
FT                   /db_xref="GOA:E1R8J2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J2"
FT                   /protein_id="ADK79336.1"
FT                   /translation="MIQGTSSNVGKSLLVAAFCRIFARKGLRVFPFKSQNMALNSFVTS
FT                   EGLEIGRAQALQATAAKRDAEVAMNPVLLKPEGNSSSQVVLMGKPWRRLSGGEYYKAKP
FT                   ALWETITEVLDRAGKENDLLIVEGAGSPAEINLKEHEIVNMRVARYLQAPVLLAADIDR
FT                   GGVFAFLYGTLALLEPEERELVKGFIINKFRGDVELLKPGLDMLRNLTGGVPTLGVVPY
FT                   LKEISLAQEDSVFLEEHRFFGSGSTEIAVMLLPHISNYDDFDALTMEPGLQLRFVEHPR
FT                   ELGNPAAIILPGTKTTMADLLWLRQSGLAEAICRKVEEGTSVIGICGGFQMLGRQIIDK
FT                   EGVEGSAGSLRGLGLLDVTTYFSREKKTIQETGTLCSDKGTLAPMKGYKVSGYEIHMGH
FT                   SALGESAGPFLATGSGGRDGAVSPDGRIIGTYFHGLFDEAAFRRGWLASLGWEPEGKPV
FT                   SLVQRREEELEALADAVEAAIDMKQLEAIIGL"
     MIQGTSSNVG KSLLVAAFCR IFARKGLRVF PFKSQNMALN SFVTSEGLEI GRAQALQATA        60
     AKRDAEVAMN PVLLKPEGNS SSQVVLMGKP WRRLSGGEYY KAKPALWETI TEVLDRAGKE       120
     NDLLIVEGAG SPAEINLKEH EIVNMRVARY LQAPVLLAAD IDRGGVFAFL YGTLALLEPE       180
     ERELVKGFII NKFRGDVELL KPGLDMLRNL TGGVPTLGVV PYLKEISLAQ EDSVFLEEHR       240
     FFGSGSTEIA VMLLPHISNY DDFDALTMEP GLQLRFVEHP RELGNPAAII LPGTKTTMAD       300
     LLWLRQSGLA EAICRKVEEG TSVIGICGGF QMLGRQIIDK EGVEGSAGSL RGLGLLDVTT       360
     YFSREKKTIQ ETGTLCSDKG TLAPMKGYKV SGYEIHMGHS ALGESAGPFL ATGSGGRDGA       420
     VSPDGRIIGT YFHGLFDEAA FRRGWLASLG WEPEGKPVSL VQRREEELEA LADAVEAAID       480
     MKQLEAIIGL                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page