(data stored in ACNUC7421 zone)

EMBL: CP002116.PE177

CP002116.PE177       Location/Qualifiers
FT   CDS             186599..187630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0180"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   aoe:Clos_0318 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79337"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J3"
FT                   /protein_id="ADK79337.1"
FT                   /translation="MVFVRRALAVFLLFVCMTSLLFAGGTQEPASDRKVAGSPQSGMSI
FT                   LGESDASVRFREVSGRIVEIPKFPKRTVIMHNSILDLWYMAGGTSLARLRGAINVPAEA
FT                   KDLPVLGSIASIDVEKIMKLEPDLLIFSGTSEYQRKISDFFASEGVASLGINYENYDDF
FT                   GLIFDLFTRLNGRRDLYEAYLIPTQEKVQSIIDRVPKGVHPKVCILFASTNYVKVETEE
FT                   TVTGDYCKRLGAVNIYRESAFEGAGRVDLSLEYILEQDPDLIFVTTMGDVEKCTARIEM
FT                   EVSSNPVWASLSAVKNGRFHYLDKSFSIYKPNRAYPEAFQRIAELLYPGTDFSLGSGEG
FT                   KAE"
     MVFVRRALAV FLLFVCMTSL LFAGGTQEPA SDRKVAGSPQ SGMSILGESD ASVRFREVSG        60
     RIVEIPKFPK RTVIMHNSIL DLWYMAGGTS LARLRGAINV PAEAKDLPVL GSIASIDVEK       120
     IMKLEPDLLI FSGTSEYQRK ISDFFASEGV ASLGINYENY DDFGLIFDLF TRLNGRRDLY       180
     EAYLIPTQEK VQSIIDRVPK GVHPKVCILF ASTNYVKVET EETVTGDYCK RLGAVNIYRE       240
     SAFEGAGRVD LSLEYILEQD PDLIFVTTMG DVEKCTARIE MEVSSNPVWA SLSAVKNGRF       300
     HYLDKSFSIY KPNRAYPEAF QRIAELLYPG TDFSLGSGEG KAE                         343
//

If you have problems or comments...

PBIL Back to PBIL home page