(data stored in ACNUC7421 zone)

EMBL: CP002116.PE178

CP002116.PE178       Location/Qualifiers
FT   CDS             187627..188652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0181"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   aoe:Clos_0319 transport system permease protein; PFAM:
FT                   transport system permease protein; SPTR: Transport system
FT                   permease protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79338"
FT                   /db_xref="GOA:E1R8J4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J4"
FT                   /protein_id="ADK79338.1"
FT                   /translation="MSRFDIRSRTGYRLAILVLLLCLLFAALLLAIRFGSSGFTFRQIL
FT                   RALFIDTTSVDHRILMMVRMPRAIAAALVGFCLALSGTLLQGVMRNPLASPNVIGVSAG
FT                   AGLAAVCIYILFPGHYFLVTPVAFGGAFLAALLVYLLAWKGGASPLRLVLSGIAVSSFL
FT                   GAGSNALMIFFPDRVQHVIGFMVGNLSAVTWQQVRILWPYAFIGFLFSMLLADRLNILL
FT                   LGDETANSLGLNVEASRMFFMLIASLLAASAVSIVGLLGFVGLIVPHVARLVIGNNARY
FT                   LIPASALLGAVVVLLCDTLGRVILRPQELPVGIIMAMLGAPFFLYLLRQKGEKMGGGHG
FT                   H"
     MSRFDIRSRT GYRLAILVLL LCLLFAALLL AIRFGSSGFT FRQILRALFI DTTSVDHRIL        60
     MMVRMPRAIA AALVGFCLAL SGTLLQGVMR NPLASPNVIG VSAGAGLAAV CIYILFPGHY       120
     FLVTPVAFGG AFLAALLVYL LAWKGGASPL RLVLSGIAVS SFLGAGSNAL MIFFPDRVQH       180
     VIGFMVGNLS AVTWQQVRIL WPYAFIGFLF SMLLADRLNI LLLGDETANS LGLNVEASRM       240
     FFMLIASLLA ASAVSIVGLL GFVGLIVPHV ARLVIGNNAR YLIPASALLG AVVVLLCDTL       300
     GRVILRPQEL PVGIIMAMLG APFFLYLLRQ KGEKMGGGHG H                           341
//

If you have problems or comments...

PBIL Back to PBIL home page