(data stored in ACNUC7421 zone)

EMBL: CP002116.PE179

CP002116.PE179       Location/Qualifiers
FT   CDS             188642..189424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0182"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: aoe:Clos_0320 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79339"
FT                   /db_xref="GOA:E1R8J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J5"
FT                   /protein_id="ADK79339.1"
FT                   /translation="MVIEADKLCLGYGGKPIVKDLSLSVPAGSWASIIGPNGCGKSTLL
FT                   KALSRNLKPVSGSVRVMDRPLDSYGGRGLARTMAFLAQTPQIPDYFSVKELVGYGRYPH
FT                   TGWFGSFRPRDREVVEQALEATDMLDFSEREVASLSGGERQRAWIAMALAQEAELLLFD
FT                   EPTTHLDIAYQFQILELIDRLRREMGRTVVTVLHDLNQAARYSDQLFVMKDGRIFATGE
FT                   PSVVLTPPLLGDVFSIDVRLLQDEEHDCPFVVPLGGKQ"
     MVIEADKLCL GYGGKPIVKD LSLSVPAGSW ASIIGPNGCG KSTLLKALSR NLKPVSGSVR        60
     VMDRPLDSYG GRGLARTMAF LAQTPQIPDY FSVKELVGYG RYPHTGWFGS FRPRDREVVE       120
     QALEATDMLD FSEREVASLS GGERQRAWIA MALAQEAELL LFDEPTTHLD IAYQFQILEL       180
     IDRLRREMGR TVVTVLHDLN QAARYSDQLF VMKDGRIFAT GEPSVVLTPP LLGDVFSIDV       240
     RLLQDEEHDC PFVVPLGGKQ                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page