(data stored in ACNUC7421 zone)

EMBL: CP002116.PE180

CP002116.PE180       Location/Qualifiers
FT   CDS             189424..190920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0183"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG1797 Cobyrinic acid a c-diamide synthase;
FT                   InterPro IPR004484:IPR002586:IPR011698:IPR017929; KEGG:
FT                   adg:Adeg_0183 cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; SPTR: Cobyrinic acid
FT                   a,c-diamide synthase; TIGRFAM: cobyrinic acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain; CobB/CobQ-like glutamine amidotransferase domain;
FT                   TIGRFAM: cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79340"
FT                   /db_xref="GOA:E1R8J6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J6"
FT                   /protein_id="ADK79340.1"
FT                   /translation="MEHISSLALPRFVIAGASSGSGKSTLTLALIEALHRRGYRPLPWK
FT                   VGPDYIDPGHLSAAAGLACRNLDPVLMGEAGMVSSFIGHCNEACRKEPKSLAVIEGVMG
FT                   LFDGRGGLSSEGSTASVAKSLSAPVIVVIDAGAAAQTAGAVALGMQQFDPDCPVAGFIA
FT                   NRIGSDRHFSMVRRAVEGATGLPVLGWLPKSSMPSMPERHLGLVAAWEEEGRQRLSSLL
FT                   RILGDAAAEHIDLDALLAIAASASSLTPIRGESVDGIDISGSSGGKADRAVAGIGTDTP
FT                   SPCIAVAMDDAFHFYYQDNLDMLESLGARIVPFSPLSASRLPDGCDGVYIGGGYPELHA
FT                   ERLSANRTMIESIRAASFDNMPIYAECGGLMYLCRRLFVGGKGYPMVGLFDTEIEMGNK
FT                   LSALGYHKARTLRPSVIGPAGMELVGHIYRWSNMVKGPSETEWLFRLDKEGTIGFDGLS
FT                   VRRSTAAYLHLHFTGVPEPARHLVAACREYRQSRSKHDEQ"
     MEHISSLALP RFVIAGASSG SGKSTLTLAL IEALHRRGYR PLPWKVGPDY IDPGHLSAAA        60
     GLACRNLDPV LMGEAGMVSS FIGHCNEACR KEPKSLAVIE GVMGLFDGRG GLSSEGSTAS       120
     VAKSLSAPVI VVIDAGAAAQ TAGAVALGMQ QFDPDCPVAG FIANRIGSDR HFSMVRRAVE       180
     GATGLPVLGW LPKSSMPSMP ERHLGLVAAW EEEGRQRLSS LLRILGDAAA EHIDLDALLA       240
     IAASASSLTP IRGESVDGID ISGSSGGKAD RAVAGIGTDT PSPCIAVAMD DAFHFYYQDN       300
     LDMLESLGAR IVPFSPLSAS RLPDGCDGVY IGGGYPELHA ERLSANRTMI ESIRAASFDN       360
     MPIYAECGGL MYLCRRLFVG GKGYPMVGLF DTEIEMGNKL SALGYHKART LRPSVIGPAG       420
     MELVGHIYRW SNMVKGPSET EWLFRLDKEG TIGFDGLSVR RSTAAYLHLH FTGVPEPARH       480
     LVAACREYRQ SRSKHDEQ                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page