(data stored in ACNUC7421 zone)

EMBL: CP002116.PE181

CP002116.PE181       Location/Qualifiers
FT   CDS             190910..191554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0184"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="COGs: COG2082 Precorrin isomerase; InterPro
FT                   IPR003722; KEGG: scl:sce0238 hypothetical protein; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH; SPTR: Precorrin-8X
FT                   methylmutase CbiC/CobH; PFAM: Precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79341"
FT                   /db_xref="GOA:E1R8J7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J7"
FT                   /protein_id="ADK79341.1"
FT                   /translation="MNSSRGKAITEESFRIIRSRLGDFSAGDDVTEIVIRIAHTTGDVE
FT                   FGKSCHVPELSVKRGIEAISSGCPIVTDVEMVRTGIRAALAEKLGCRVHCFLNDTKVID
FT                   GTRQSGETRSALGMRQAAEHSLLNGAVVAIGNAPTALFALLSMIESGRVKPALVVGIPV
FT                   GFVGALESKQALYDSGYPCITNLSERGGSPIAAAIVNGLLFLAEQRAEQRG"
     MNSSRGKAIT EESFRIIRSR LGDFSAGDDV TEIVIRIAHT TGDVEFGKSC HVPELSVKRG        60
     IEAISSGCPI VTDVEMVRTG IRAALAEKLG CRVHCFLNDT KVIDGTRQSG ETRSALGMRQ       120
     AAEHSLLNGA VVAIGNAPTA LFALLSMIES GRVKPALVVG IPVGFVGALE SKQALYDSGY       180
     PCITNLSERG GSPIAAAIVN GLLFLAEQRA EQRG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page