(data stored in ACNUC7421 zone)

EMBL: CP002116.PE182

CP002116.PE182       Location/Qualifiers
FT   CDS             191557..192696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0185"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="COGs: COG1903 Cobalamin biosynthesis protein CbiD;
FT                   InterPro IPR002748; KEGG: pth:PTH_0951 cobalamin
FT                   biosynthesis protein; PFAM: cobalamin (vitamin B12)
FT                   biosynthesis CbiD protein; SPTR: Cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79342"
FT                   /db_xref="GOA:E1R8J8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J8"
FT                   /protein_id="ADK79342.1"
FT                   /translation="MAQWYDQELGKVSGMRLGITTGSCAQAAARAALEFLLGIFADKRV
FT                   EITLPKGHRRYSGRQILVPVESIGATSDGTGAEALVRKDSGDDPDITDGILIGARVRLK
FT                   EGNGVEIDGAEGVGRITRPGLAGKVGEAAINPIPRRMIREELLPLLPEGKGCRVEIFVP
FT                   EGIALAEKTWNPRIGILGGISIIGTKGVVEPKSEEAYKASINRVIHSYLKSGMSRLIIT
FT                   PGYVGEAFLSSRGIALDRVVTVGDHVGHALLRGADHGAKELLLVGHIGKLTKIAVAMFN
FT                   THWSSGDARLEVIAAYAGAAGASAEKVRRLLSLSLAEEAVALIHDWGLDEIWNAIARRA
FT                   AERTEKLVEGRCTIGVVLLDLKGHSLGSWPKERVEGWLK"
     MAQWYDQELG KVSGMRLGIT TGSCAQAAAR AALEFLLGIF ADKRVEITLP KGHRRYSGRQ        60
     ILVPVESIGA TSDGTGAEAL VRKDSGDDPD ITDGILIGAR VRLKEGNGVE IDGAEGVGRI       120
     TRPGLAGKVG EAAINPIPRR MIREELLPLL PEGKGCRVEI FVPEGIALAE KTWNPRIGIL       180
     GGISIIGTKG VVEPKSEEAY KASINRVIHS YLKSGMSRLI ITPGYVGEAF LSSRGIALDR       240
     VVTVGDHVGH ALLRGADHGA KELLLVGHIG KLTKIAVAMF NTHWSSGDAR LEVIAAYAGA       300
     AGASAEKVRR LLSLSLAEEA VALIHDWGLD EIWNAIARRA AERTEKLVEG RCTIGVVLLD       360
     LKGHSLGSWP KERVEGWLK                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page