(data stored in ACNUC7421 zone)

EMBL: CP002116.PE183

CP002116.PE183       Location/Qualifiers
FT   CDS             192693..193367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0186"
FT                   /product="Precorrin-6B methylase 1"
FT                   /note="COGs: COG2241 Precorrin-6B methylase 1; KEGG:
FT                   cac:CAC0584 precorrin-6B methylase 1 CobL1/CbiE; SPTR:
FT                   Precorrin-6y C5,15-methyltransferase (Decarboxylating),
FT                   CbiE subunit; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79343"
FT                   /db_xref="GOA:E1R8J9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8J9"
FT                   /protein_id="ADK79343.1"
FT                   /translation="MIHIIGTGPGDGRYTLDLARETIKTCTVFAGFRSHALRFIPPSSP
FT                   FVDLSSDGGVGIYSGLDEIDRLRLGGEDEIGILVSGDPGFHSLLPLVRSRYPQWELRIV
FT                   PGLSAFQVACAKIGIPWQELELVSLHGSGGEDIASFVRRFVSHPPSGMSGFVVLTAGPR
FT                   GDRDLAERIIVEEPRFRGFKAWFCWDIGEDGESIAYCRLDAVQEGGRLCTIIMHRMEEE
FT                   SV"
     MIHIIGTGPG DGRYTLDLAR ETIKTCTVFA GFRSHALRFI PPSSPFVDLS SDGGVGIYSG        60
     LDEIDRLRLG GEDEIGILVS GDPGFHSLLP LVRSRYPQWE LRIVPGLSAF QVACAKIGIP       120
     WQELELVSLH GSGGEDIASF VRRFVSHPPS GMSGFVVLTA GPRGDRDLAE RIIVEEPRFR       180
     GFKAWFCWDI GEDGESIAYC RLDAVQEGGR LCTIIMHRME EESV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page