(data stored in ACNUC7421 zone)

EMBL: CP002116.PE185

CP002116.PE185       Location/Qualifiers
FT   CDS             194137..195780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0188"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="COGs: COG1010 Precorrin-3B methylase; InterPro
FT                   IPR006363:IPR002750:IPR000878; KEGG: rca:Rcas_0637
FT                   precorrin-3B C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   cobalamin (vitamin B12) biosynthesis CbiG protein; SPTR:
FT                   Precorrin-3B C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Cobalamin synthesis G
FT                   C-terminus; Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   Cobalamin synthesis G N-terminal; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79345"
FT                   /db_xref="GOA:E1R8K1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K1"
FT                   /protein_id="ADK79345.1"
FT                   /translation="MKLAALCINEAGKNAAALLAGQMPDLSVVDCSRPGSLAEESARLF
FT                   PLYEGLIFFSAVGIAVRMISGFLRDKYHDPAVVVVDNGCRNAVSLLSGHEGGANRLCWE
FT                   VSRILGCRPVVSTATEARRSIVLGIGTRKDIAASTVAEAVTTALMEAGLSLSDVRIAAT
FT                   IGKKCLEPGLLEALADLDIPLSRVSAREISRFSGAFLPSAAARHIGIPAVAEPCALLAA
FT                   RQGSLIAPLYRRDGVTVAIARERIGPLSISDELSASADLPQVSESINSVNGGSAGEHAG
FT                   GEAEGLPPHRKLHTKGVLYVVGIGPGSPEHMTLAAVRAIEACEVVVGYHRYLELLGELI
FT                   EGKEIFASGMRKEKDRAAAAIDLARTGRIVTVVSTGDAGIYGMAGLILELAGTEAGERF
FT                   DLRIIPGVTAASSAAALLGAPLMHDFAVISLSDLLTEASLIEKRLRLAAEGDFITVLYN
FT                   PKSRSRKALLEKALDSFRACRPLDTPAAVVTNALREGQSVRLESLGSIDADDPDIGMSS
FT                   VVVIGNSSSYRQGRWFITPRGYKIEEPHEG"
     MKLAALCINE AGKNAAALLA GQMPDLSVVD CSRPGSLAEE SARLFPLYEG LIFFSAVGIA        60
     VRMISGFLRD KYHDPAVVVV DNGCRNAVSL LSGHEGGANR LCWEVSRILG CRPVVSTATE       120
     ARRSIVLGIG TRKDIAASTV AEAVTTALME AGLSLSDVRI AATIGKKCLE PGLLEALADL       180
     DIPLSRVSAR EISRFSGAFL PSAAARHIGI PAVAEPCALL AARQGSLIAP LYRRDGVTVA       240
     IARERIGPLS ISDELSASAD LPQVSESINS VNGGSAGEHA GGEAEGLPPH RKLHTKGVLY       300
     VVGIGPGSPE HMTLAAVRAI EACEVVVGYH RYLELLGELI EGKEIFASGM RKEKDRAAAA       360
     IDLARTGRIV TVVSTGDAGI YGMAGLILEL AGTEAGERFD LRIIPGVTAA SSAAALLGAP       420
     LMHDFAVISL SDLLTEASLI EKRLRLAAEG DFITVLYNPK SRSRKALLEK ALDSFRACRP       480
     LDTPAAVVTN ALREGQSVRL ESLGSIDADD PDIGMSSVVV IGNSSSYRQG RWFITPRGYK       540
     IEEPHEG                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page