(data stored in ACNUC7421 zone)

EMBL: CP002116.PE186

CP002116.PE186       Location/Qualifiers
FT   CDS             195770..196036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0189"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG2158 Uncharacterized protein containing a
FT                   Zn-finger-like domain; InterPro IPR007212; KEGG:
FT                   dsa:Desal_0255 cysteine-rich small domain protein; PFAM:
FT                   cysteine-rich small domain; SPTR: Cysteine-rich small
FT                   domain protein; PFAM: Cysteine-rich small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79346"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K2"
FT                   /protein_id="ADK79346.1"
FT                   /translation="MKDKRPYSHKFFENRDCRYYPCHQGIEEMNCLFCFCPLYQFPDCG
FT                   GDYRLTADGVKDCTGCIRPHIPENYDLIIAELKRRKSPPGKKK"
     MKDKRPYSHK FFENRDCRYY PCHQGIEEMN CLFCFCPLYQ FPDCGGDYRL TADGVKDCTG        60
     CIRPHIPENY DLIIAELKRR KSPPGKKK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page