(data stored in ACNUC7421 zone)

EMBL: CP002116.PE188

CP002116.PE188       Location/Qualifiers
FT   CDS             197004..197432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0191"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002850:IPR002716; KEGG: cyc:PCC7424_2307
FT                   PilT protein domain protein; PFAM: PilT protein domain
FT                   protein; SPTR: PilT protein domain protein; PFAM: PIN
FT                   domain; TIGRFAM: conserved hypothetical protein TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79348"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K4"
FT                   /protein_id="ADK79348.1"
FT                   /translation="MNAFPVVIDTNVILSGLRFRNGFSFTLLKQIPEKLFTMCISVPLI
FT                   LEYETVLTKHMKQTGLTKEDIGDFIDYTCCVGRRTEIFYLWRPVLKDPFDDHVLELAVA
FT                   SGSRYIISFNKKDFSPARSFGIGVVSPKEFLQSKEEIE"
     MNAFPVVIDT NVILSGLRFR NGFSFTLLKQ IPEKLFTMCI SVPLILEYET VLTKHMKQTG        60
     LTKEDIGDFI DYTCCVGRRT EIFYLWRPVL KDPFDDHVLE LAVASGSRYI ISFNKKDFSP       120
     ARSFGIGVVS PKEFLQSKEE IE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page