(data stored in ACNUC7421 zone)

EMBL: CP002116.PE191

CP002116.PE191       Location/Qualifiers
FT   CDS             complement(198520..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0194"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG:
FT                   pca:Pcar_3024 ABC-type transport system, permease
FT                   component; PFAM: ABC-3 protein; SPTR: ABC-type transport
FT                   system, permease component; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79351"
FT                   /db_xref="GOA:E1R8K7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8K7"
FT                   /protein_id="ADK79351.1"
FT                   /translation="MLNFFGQFFHDLVTFPFLRNALLACLFLAPAAGIIGTYVTVERIN
FT                   SMAGAVAHSVLAGLGAARFLQVSFGWSYPTPLQGAAVAAVIVALIIGGITGRGRERTET
FT                   VLAAIWAIGMAIGIFFIAATPGYSQDLMSYLFGNILMIRKSDTILLLVMDLVLILVILF
FT                   RYKEIFAVTFDGEFAALRGVKVRRIYYLMLLLTSLTIVLAVQLVGIVMVIALLTLPAAT
FT                   AGLFSHTLWKMMIFASLLSFLYTGGGLAISYSADKPAGATIILFAAAVYLGTMLVKRRT
FT                   R"
     MLNFFGQFFH DLVTFPFLRN ALLACLFLAP AAGIIGTYVT VERINSMAGA VAHSVLAGLG        60
     AARFLQVSFG WSYPTPLQGA AVAAVIVALI IGGITGRGRE RTETVLAAIW AIGMAIGIFF       120
     IAATPGYSQD LMSYLFGNIL MIRKSDTILL LVMDLVLILV ILFRYKEIFA VTFDGEFAAL       180
     RGVKVRRIYY LMLLLTSLTI VLAVQLVGIV MVIALLTLPA ATAGLFSHTL WKMMIFASLL       240
     SFLYTGGGLA ISYSADKPAG ATIILFAAAV YLGTMLVKRR TR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page