(data stored in ACNUC7421 zone)

EMBL: CP002116.PE192

CP002116.PE192       Location/Qualifiers
FT   CDS             complement(199362..200171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0195"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871:IPR018184; KEGG:
FT                   pca:Pcar_3025 ABC-type transport system, ATP binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79352"
FT                   /db_xref="GOA:E1RA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA61"
FT                   /protein_id="ADK79352.1"
FT                   /translation="MSDNEGRGAPSTEPLSVVNFEDVSFGYGEDRVLESVSFEILQGDF
FT                   AAIIGPNGGGKTTILKLILGLLIPDEGRIRLFDSPSEEARKRVGYVPQYTLFDPLFPAT
FT                   VEDVVLMGRLGAKSRLGFFRREDRRIAASALKTVGLEGLEKRPFPALSGGQRQRVLIAR
FT                   ALASEADLLILDEPTSNVDRTAEKEIYTLLGSLKGEKTILLVSHDTAVVSNLADTILCI
FT                   NRTLARHPGCELTGEDLGKLYGDDMKLVLHDIHNEASAASAKEDSTC"
     MSDNEGRGAP STEPLSVVNF EDVSFGYGED RVLESVSFEI LQGDFAAIIG PNGGGKTTIL        60
     KLILGLLIPD EGRIRLFDSP SEEARKRVGY VPQYTLFDPL FPATVEDVVL MGRLGAKSRL       120
     GFFRREDRRI AASALKTVGL EGLEKRPFPA LSGGQRQRVL IARALASEAD LLILDEPTSN       180
     VDRTAEKEIY TLLGSLKGEK TILLVSHDTA VVSNLADTIL CINRTLARHP GCELTGEDLG       240
     KLYGDDMKLV LHDIHNEASA ASAKEDSTC                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page