(data stored in ACNUC7421 zone)

EMBL: CP002116.PE193

CP002116.PE193       Location/Qualifiers
FT   CDS             complement(200171..201127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0196"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127;
FT                   KEGG: dal:Dalk_1551 periplasmic solute binding protein;
FT                   PFAM: periplasmic solute binding protein; SPTR: Periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79353"
FT                   /db_xref="GOA:E1RA62"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA62"
FT                   /protein_id="ADK79353.1"
FT                   /translation="MKRHKKRCSIVSALLFMLIASLPLMAGGNRESAPTSGDSEKPIVY
FT                   SSILPVQFLADRIGGDRITSEVVVLPGESPATYEPTPKQMSALAQASLLFRVGVPFENG
FT                   FLPKVRELSPDLTIIDLRKGLTLRTMDAAHSHDEEHDGDHEGEGEDGHDHEAGTPDPHI
FT                   WMSPRNMMIMAQTMADALAAADPDGAELYKDNLAGLESDLKTLDERLAQDLEPLRGKRF
FT                   FVYHPAFGYFADDYGLIQIPLEIEGKEPTPKQLVFYIEEAKELDVEIIFVQPEFPRQSA
FT                   QTVAKEIGGMVVPVSALAKEYIANLDTVASALEEGLR"
     MKRHKKRCSI VSALLFMLIA SLPLMAGGNR ESAPTSGDSE KPIVYSSILP VQFLADRIGG        60
     DRITSEVVVL PGESPATYEP TPKQMSALAQ ASLLFRVGVP FENGFLPKVR ELSPDLTIID       120
     LRKGLTLRTM DAAHSHDEEH DGDHEGEGED GHDHEAGTPD PHIWMSPRNM MIMAQTMADA       180
     LAAADPDGAE LYKDNLAGLE SDLKTLDERL AQDLEPLRGK RFFVYHPAFG YFADDYGLIQ       240
     IPLEIEGKEP TPKQLVFYIE EAKELDVEII FVQPEFPRQS AQTVAKEIGG MVVPVSALAK       300
     EYIANLDTVA SALEEGLR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page