(data stored in ACNUC7421 zone)

EMBL: CP002116.PE194

CP002116.PE194       Location/Qualifiers
FT   CDS             complement(201102..201392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmg:100209601 similar to Zinc finger protein
FT                   418; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79354"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA63"
FT                   /protein_id="ADK79354.1"
FT                   /translation="MAQQKEETITFKVDPALAELLRRVPNRSEFIRKALFAQLDNVCPL
FT                   CQGSGYLTPDQKNHWEKFSKHHHVVRCESCHEYYLSCDLKEDHHEASQKEM"
     MAQQKEETIT FKVDPALAEL LRRVPNRSEF IRKALFAQLD NVCPLCQGSG YLTPDQKNHW        60
     EKFSKHHHVV RCESCHEYYL SCDLKEDHHE ASQKEM                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page