(data stored in ACNUC7421 zone)

EMBL: CP002116.PE195

CP002116.PE195       Location/Qualifiers
FT   CDS             complement(201481..202368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0198"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR017871; KEGG: ere:EUBREC_1090
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR:
FT                   Transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79355"
FT                   /db_xref="GOA:E1RA64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA64"
FT                   /protein_id="ADK79355.1"
FT                   /translation="MINPNFEYYKIFYYVGKHQNLTTAAHLLLTSQPSVSRSIKNLEHD
FT                   LSCRLFVRSKKGVTFTPEGALLYSHIASACESIFEGEKALSRALHLESGAVAIGTTEIA
FT                   IHCYLLEKLASFHKAHPKVTLTIINRSAPALIDEIKSGAIDIAVVTTPIEGEKNLTITK
FT                   VKKFRDILVAGPAFSHLGDRVLTIEELPTYPLITLSKETATYRFYSSLYASHEMTWKAD
FT                   IELATADLLIPFIKQNLGIGFVPHIMASPALASGEIRALTLSTDIPEREICIVQDKRHP
FT                   LSAASRQLIHWLAP"
     MINPNFEYYK IFYYVGKHQN LTTAAHLLLT SQPSVSRSIK NLEHDLSCRL FVRSKKGVTF        60
     TPEGALLYSH IASACESIFE GEKALSRALH LESGAVAIGT TEIAIHCYLL EKLASFHKAH       120
     PKVTLTIINR SAPALIDEIK SGAIDIAVVT TPIEGEKNLT ITKVKKFRDI LVAGPAFSHL       180
     GDRVLTIEEL PTYPLITLSK ETATYRFYSS LYASHEMTWK ADIELATADL LIPFIKQNLG       240
     IGFVPHIMAS PALASGEIRA LTLSTDIPER EICIVQDKRH PLSAASRQLI HWLAP            295
//

If you have problems or comments...

PBIL Back to PBIL home page