(data stored in ACNUC7421 zone)

EMBL: CP002116.PE196

CP002116.PE196       Location/Qualifiers
FT   CDS             202501..202911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccu:Ccur_10090 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79356"
FT                   /db_xref="GOA:E1RA65"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA65"
FT                   /protein_id="ADK79356.1"
FT                   /translation="MLDLLEALMILCFGLSWPISIYRSYVSRTAKGKSLFFEVFLWIGY
FT                   VFGISRKILQWYGSDSASLNFLFYLGWFFYILNIVEITIDMGLYFRNVKLDREREAEPG
FT                   IERAEEVIEESNEIIEQMKELERGLDGKAKGK"
     MLDLLEALMI LCFGLSWPIS IYRSYVSRTA KGKSLFFEVF LWIGYVFGIS RKILQWYGSD        60
     SASLNFLFYL GWFFYILNIV EITIDMGLYF RNVKLDRERE AEPGIERAEE VIEESNEIIE       120
     QMKELERGLD GKAKGK                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page