(data stored in ACNUC7421 zone)

EMBL: CP002116.PE197

CP002116.PE197       Location/Qualifiers
FT   CDS             203035..204087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0200"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="InterPro IPR001509; KEGG: gym:GYMC10_0509
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD dependent
FT                   epimerase/dehydratase family protein; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79357"
FT                   /db_xref="GOA:E1RA66"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA66"
FT                   /protein_id="ADK79357.1"
FT                   /translation="MSYLKRERLPEYIESEEELDDLMSLPSKQLIDFQKNLEGDLIILG
FT                   VGGKIGVQLALAAKKASIAAAVPRRIIGVSRFSNPEKRTQLEEKGIETISCDLSDPVAV
FT                   KQLPDAKNVVFMVGRKFGTCGSEEETWAMNTLVPDYVSRRYANSAIVVYSTGNVYGLVP
FT                   VNCGGSIEADTLHPQGEYAISALGRERIFQYYSKKNETPISILRLNYAIDLRYGVLREI
FT                   GEKVKNQEVIDLSMGNVNVIWQGDVINQTLLSFAHCTSPANIINITGPETVSIRYVAGR
FT                   FSRLFNKPLRLEGEESGTALLNNASYAASLFGYPHVSLLTMVKWIAHWLEIGGTSLDKP
FT                   THFASRNGIF"
     MSYLKRERLP EYIESEEELD DLMSLPSKQL IDFQKNLEGD LIILGVGGKI GVQLALAAKK        60
     ASIAAAVPRR IIGVSRFSNP EKRTQLEEKG IETISCDLSD PVAVKQLPDA KNVVFMVGRK       120
     FGTCGSEEET WAMNTLVPDY VSRRYANSAI VVYSTGNVYG LVPVNCGGSI EADTLHPQGE       180
     YAISALGRER IFQYYSKKNE TPISILRLNY AIDLRYGVLR EIGEKVKNQE VIDLSMGNVN       240
     VIWQGDVINQ TLLSFAHCTS PANIINITGP ETVSIRYVAG RFSRLFNKPL RLEGEESGTA       300
     LLNNASYAAS LFGYPHVSLL TMVKWIAHWL EIGGTSLDKP THFASRNGIF                  350
//

If you have problems or comments...

PBIL Back to PBIL home page