(data stored in ACNUC7421 zone)

EMBL: CP002116.PE198

CP002116.PE198       Location/Qualifiers
FT   CDS             204099..205157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0201"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR002136; KEGG: rba:RB7999 hypothetical protein;
FT                   PFAM: dihydrodipicolinate synthetase; ribosomal protein
FT                   L4/L1e; SPTR: Putative uncharacterized protein; PFAM:
FT                   Dihydrodipicolinate synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79358"
FT                   /db_xref="GOA:E1RA67"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA67"
FT                   /protein_id="ADK79358.1"
FT                   /translation="MNMKEIRRLLFQGMAIPAIPLALHEDGTFDPLHQRALLRYYIDSG
FT                   VGGIAAAVHTTQFEIRERPDFFRDFLTFVSGEISSYAAKKGRQILKIGGVCGNTKAAVS
FT                   EAGLLREKGFDLGLLSLATFKGKSPDSILEHCRKVAKEIPLFGFYLQPAVGGIPLSRDF
FT                   WKDFASIPNVLGIKVAPFNRYKTLDVVQGVSEAGRGHEVALYTGNDDSIIFDLLSSYPC
FT                   SGEEGRALRFSGGLLGHWCVWTSKAVELLEEIKKLRAKGSDIPFELLERAQKITDANAA
FT                   IFDAQNDFAGVIPGVHEILRRQGLLESRRCLDPSLELSPSQMGEIERVIGAYPELQDDA
FT                   FISLHIDQWLTN"
     MNMKEIRRLL FQGMAIPAIP LALHEDGTFD PLHQRALLRY YIDSGVGGIA AAVHTTQFEI        60
     RERPDFFRDF LTFVSGEISS YAAKKGRQIL KIGGVCGNTK AAVSEAGLLR EKGFDLGLLS       120
     LATFKGKSPD SILEHCRKVA KEIPLFGFYL QPAVGGIPLS RDFWKDFASI PNVLGIKVAP       180
     FNRYKTLDVV QGVSEAGRGH EVALYTGNDD SIIFDLLSSY PCSGEEGRAL RFSGGLLGHW       240
     CVWTSKAVEL LEEIKKLRAK GSDIPFELLE RAQKITDANA AIFDAQNDFA GVIPGVHEIL       300
     RRQGLLESRR CLDPSLELSP SQMGEIERVI GAYPELQDDA FISLHIDQWL TN               352
//

If you have problems or comments...

PBIL Back to PBIL home page