(data stored in ACNUC7421 zone)

EMBL: CP002116.PE199

CP002116.PE199       Location/Qualifiers
FT   CDS             205170..206381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0202"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: phe:Phep_1689 natural
FT                   resistance-associated macrophage protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79359"
FT                   /db_xref="GOA:E1RA68"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA68"
FT                   /protein_id="ADK79359.1"
FT                   /translation="MDKKGKGISQLAFLLGPGVITAATVLGPGSITVSSKSGALMEYSV
FT                   LWAVVIAGIFMATFTRMAARIGCLNDDSLLNIVRTKQHPVLAVVVGLSVFLIAGGFQTG
FT                   NNIGVGLAMDAMFGGGIMLWAPVFTIIALLFIWISRDFYKLLEKVMMTLVVIMIVAFIA
FT                   NVFMAGPSVGKIALGLVPSQPKIWGLVIAISATSFSIAAAAYQAYLVQGKGWSAAFLKK
FT                   AQRDATIGIVILCGLAALIMITSAAVLAPRGIGVKSAVDMAIQLEPLLGPLAKWLFLFG
FT                   LLAASFSSFISNAVLGGMFLSDGFGLGKSLNDISVKVFTTVLLLFSTTLAVILKTNPIE
FT                   VLVVAQASTILGGPLVAIVLLLLGNNKDVLQEHTNKPVTNVIAVLAILWISYLSYNQLM
FT                   AFIG"
     MDKKGKGISQ LAFLLGPGVI TAATVLGPGS ITVSSKSGAL MEYSVLWAVV IAGIFMATFT        60
     RMAARIGCLN DDSLLNIVRT KQHPVLAVVV GLSVFLIAGG FQTGNNIGVG LAMDAMFGGG       120
     IMLWAPVFTI IALLFIWISR DFYKLLEKVM MTLVVIMIVA FIANVFMAGP SVGKIALGLV       180
     PSQPKIWGLV IAISATSFSI AAAAYQAYLV QGKGWSAAFL KKAQRDATIG IVILCGLAAL       240
     IMITSAAVLA PRGIGVKSAV DMAIQLEPLL GPLAKWLFLF GLLAASFSSF ISNAVLGGMF       300
     LSDGFGLGKS LNDISVKVFT TVLLLFSTTL AVILKTNPIE VLVVAQASTI LGGPLVAIVL       360
     LLLGNNKDVL QEHTNKPVTN VIAVLAILWI SYLSYNQLMA FIG                         403
//

If you have problems or comments...

PBIL Back to PBIL home page