(data stored in ACNUC7421 zone)

EMBL: CP002116.PE200

CP002116.PE200       Location/Qualifiers
FT   CDS             206388..207074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0203"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: reu:Reut_A1048 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79360"
FT                   /db_xref="GOA:E1RA69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA69"
FT                   /protein_id="ADK79360.1"
FT                   /translation="MLSGLASKEQYVPVLLFLPMLKFESDGIVMQKRSRDTKERIFKAA
FT                   VEEFAKSGFHGARVDNIAKKAKSNKERIYAYFGSKEDLFIEVWKRTYMLIIEVDEQFMD
FT                   LTDEDIPSLTGIILKRYVHFHQEHSEFWKIFVWENMLDGKHTEKVKGFKERPYKHLRRL
FT                   YARGQELGFFSREVSFETYMFVITAVSFFYASNRCTMSQSLSINLTNNDVVEGMIEEAT
FT                   KMLNGK"
     MLSGLASKEQ YVPVLLFLPM LKFESDGIVM QKRSRDTKER IFKAAVEEFA KSGFHGARVD        60
     NIAKKAKSNK ERIYAYFGSK EDLFIEVWKR TYMLIIEVDE QFMDLTDEDI PSLTGIILKR       120
     YVHFHQEHSE FWKIFVWENM LDGKHTEKVK GFKERPYKHL RRLYARGQEL GFFSREVSFE       180
     TYMFVITAVS FFYASNRCTM SQSLSINLTN NDVVEGMIEE ATKMLNGK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page