(data stored in ACNUC7421 zone)

EMBL: CP002116.PE201

CP002116.PE201       Location/Qualifiers
FT   CDS             207078..208277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0204"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro
FT                   IPR010169:IPR002933:IPR011650:IPR001261; KEGG:
FT                   bid:Bind_1040 acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Acetylornithine deacetylase (ArgE); TIGRFAM:
FT                   acetylornithine deacetylase (ArgE); PFAM: Peptidase family
FT                   M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79361"
FT                   /db_xref="GOA:E1RA70"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA70"
FT                   /protein_id="ADK79361.1"
FT                   /translation="MIMEQQLEKISQEAVRILSDLVSFRSVSGSDNEDIITYIADYLIS
FT                   YGLSPKRISAGRSHSNNLFVTIGESRDGGVLLSGHTDIVPASGAGWDSDPFVLSPRQVC
FT                   GEEMLYGRGACDMKGFLAAILALVPRWIEKRLGCNKEPIHLAFTYDEEIGCIGVDDLIA
FT                   ELGSCLPRPDAVLVGEPTLLRPADGHKSASRYITTVKGVSTHSSRPASGVNAIYGANHL
FT                   IAELQRFAGEIQSRSSRDPEARRFDPPYSTISLGTIHGGTAINVVAEQCELGWEARALP
FT                   WEDPQQYLRHIEDFSRHLSETLPDGKKLVFTHRLDSFLPGLSPKASKAYGYYQAMMVAG
FT                   NKIPQPTTTVAFGTEAGKYDQAGIPALIWGPGSIDRAHGKNEYIEKQQLVDCCALLSKL
FT                   "
     MIMEQQLEKI SQEAVRILSD LVSFRSVSGS DNEDIITYIA DYLISYGLSP KRISAGRSHS        60
     NNLFVTIGES RDGGVLLSGH TDIVPASGAG WDSDPFVLSP RQVCGEEMLY GRGACDMKGF       120
     LAAILALVPR WIEKRLGCNK EPIHLAFTYD EEIGCIGVDD LIAELGSCLP RPDAVLVGEP       180
     TLLRPADGHK SASRYITTVK GVSTHSSRPA SGVNAIYGAN HLIAELQRFA GEIQSRSSRD       240
     PEARRFDPPY STISLGTIHG GTAINVVAEQ CELGWEARAL PWEDPQQYLR HIEDFSRHLS       300
     ETLPDGKKLV FTHRLDSFLP GLSPKASKAY GYYQAMMVAG NKIPQPTTTV AFGTEAGKYD       360
     QAGIPALIWG PGSIDRAHGK NEYIEKQQLV DCCALLSKL                              399
//

If you have problems or comments...

PBIL Back to PBIL home page