(data stored in ACNUC7421 zone)

EMBL: CP002116.PE202

CP002116.PE202       Location/Qualifiers
FT   CDS             208342..209445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7828 peptidase M14, carboxypeptidase
FT                   A; SPTR: Glycoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79362"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA71"
FT                   /protein_id="ADK79362.1"
FT                   /translation="MEKKSRIILLIGLGLFLCLCSPLFADPGLEALYKEHFDTLVTSVY
FT                   PLFDVRFFPSGALEDSFSPLEEQRAQELFSVLDDYLDKDEDPHPYLIDARDYGTKAFAE
FT                   GAFSIGTYAAGDDFPSLFPVIEPKFTPDGNDAMIRLALSKRAFDEEGVATAVAVAQFAN
FT                   LLKQFYDANHNSIVQFINGRNLSEEFLYMRDALMVQDSVIEFYLDASDKTLEGAEFFLA
FT                   DSFFRDQMDSVMMLGYGIDQRMMKFLDTRYQVLLSQQENFESFIDGFDQMIQGAEDNAP
FT                   DPEQGSEFDLLIYRNRVATMWIFQGWYLALLPGRFPVYDAPEPIKMKLSALLRRWEGME
FT                   DDILASEAMLTQKRTEFVARIMEPADG"
     MEKKSRIILL IGLGLFLCLC SPLFADPGLE ALYKEHFDTL VTSVYPLFDV RFFPSGALED        60
     SFSPLEEQRA QELFSVLDDY LDKDEDPHPY LIDARDYGTK AFAEGAFSIG TYAAGDDFPS       120
     LFPVIEPKFT PDGNDAMIRL ALSKRAFDEE GVATAVAVAQ FANLLKQFYD ANHNSIVQFI       180
     NGRNLSEEFL YMRDALMVQD SVIEFYLDAS DKTLEGAEFF LADSFFRDQM DSVMMLGYGI       240
     DQRMMKFLDT RYQVLLSQQE NFESFIDGFD QMIQGAEDNA PDPEQGSEFD LLIYRNRVAT       300
     MWIFQGWYLA LLPGRFPVYD APEPIKMKLS ALLRRWEGME DDILASEAML TQKRTEFVAR       360
     IMEPADG                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page