(data stored in ACNUC7421 zone)

EMBL: CP002116.PE203

CP002116.PE203       Location/Qualifiers
FT   CDS             209438..211105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0206"
FT                   /product="Ankyrin"
FT                   /note="InterPro IPR002110:IPR020683; KEGG: afv:AFLA_025240
FT                   ankyrin repeat-containing protein, putative; PFAM: Ankyrin;
FT                   SMART: Ankyrin; SPTR: Ankyrin repeat-containing protein,
FT                   putative; PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79363"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA72"
FT                   /protein_id="ADK79363.1"
FT                   /translation="MVELQRGAAVALLLLCFSGWGFSLPEDHRPSLLSMEELSQAALQV
FT                   HDRYEIPYPPLADITLLYDGARVRAWIEACNEGKAQPMPRRWFTGTGTGFSSMIYMSCV
FT                   SFLTGKGWALAESAFEKRLGNDSVNERNRAILNAFLAIDNQEEMKEAAPRFFPFSMFLK
FT                   RRELGDGVSIMLPDVAWKLLPSGSTPLARTLVYGDEGFLRGLGYDRKRVGPGYDIRRDP
FT                   IAMASCIKVRMEKAINGNGTYLPLRPGMPFAIAKKVAVGDFFADTIWFQPFISAPDGVE
FT                   TGAEGRLYFKQGNQLFVVSLFSMVDSSHPAADGDLLLGEAASLLSTLQFPAEDTLLDSH
FT                   RLAALSDLLHAGDVSLLRPELQTIVRETGSIHFPDSHGEPFWHKIFLDFDRDDPRREAL
FT                   LKLFISLGINPDASGPSGKRAVDYVVEQGDAGLLEDVLLARAHGDYLTKDGSSPLIEAA
FT                   SGGDVWCVLTLLRAGVNVDLPDIRGRSALHWAARHDYLAVAKLLLEKGASPESRDIAGK
FT                   SPLDLSPAFQDMRRSPLFVMVQKFCGSPTWAKVQPEEQ"
     MVELQRGAAV ALLLLCFSGW GFSLPEDHRP SLLSMEELSQ AALQVHDRYE IPYPPLADIT        60
     LLYDGARVRA WIEACNEGKA QPMPRRWFTG TGTGFSSMIY MSCVSFLTGK GWALAESAFE       120
     KRLGNDSVNE RNRAILNAFL AIDNQEEMKE AAPRFFPFSM FLKRRELGDG VSIMLPDVAW       180
     KLLPSGSTPL ARTLVYGDEG FLRGLGYDRK RVGPGYDIRR DPIAMASCIK VRMEKAINGN       240
     GTYLPLRPGM PFAIAKKVAV GDFFADTIWF QPFISAPDGV ETGAEGRLYF KQGNQLFVVS       300
     LFSMVDSSHP AADGDLLLGE AASLLSTLQF PAEDTLLDSH RLAALSDLLH AGDVSLLRPE       360
     LQTIVRETGS IHFPDSHGEP FWHKIFLDFD RDDPRREALL KLFISLGINP DASGPSGKRA       420
     VDYVVEQGDA GLLEDVLLAR AHGDYLTKDG SSPLIEAASG GDVWCVLTLL RAGVNVDLPD       480
     IRGRSALHWA ARHDYLAVAK LLLEKGASPE SRDIAGKSPL DLSPAFQDMR RSPLFVMVQK       540
     FCGSPTWAKV QPEEQ                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page