(data stored in ACNUC7421 zone)

EMBL: CP002116.PE204

CP002116.PE204       Location/Qualifiers
FT   CDS             complement(211015..211278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1032 transcriptional regulator; SPTR:
FT                   Putative transcriptional regulator, AsnC family; PFAM: FeoC
FT                   like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79364"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA73"
FT                   /protein_id="ADK79364.1"
FT                   /translation="MQYRSILQQIKEEGRVDKASIAEKQETTVAMIEMLLTELERLGYL
FT                   QRDALARCSGACTHCSSGCTFAHVGLPQNFWTITNKGERLIS"
     MQYRSILQQI KEEGRVDKAS IAEKQETTVA MIEMLLTELE RLGYLQRDAL ARCSGACTHC        60
     SSGCTFAHVG LPQNFWTITN KGERLIS                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page