(data stored in ACNUC7421 zone)

EMBL: CP002116.PE205

CP002116.PE205       Location/Qualifiers
FT   CDS             211335..211826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0208"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358:IPR017969; KEGG: sga:GALLO_0915
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0153; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79365"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA74"
FT                   /protein_id="ADK79365.1"
FT                   /translation="MDPEYRILIQTAESRGRLYRDLVRKLRRVAPKELAAVMQELHDEA
FT                   FRRIDCLKCAHCCAVVGPRLTDTDIQRLGKALSMKPSAFEDTYLIRDEDGDLVFREHPC
FT                   PFLLADNRCLLYDRRPKACREYPHTDDKHARGLLKISLVNTRFCPIVALVFQGLEERYG
FT                   "
     MDPEYRILIQ TAESRGRLYR DLVRKLRRVA PKELAAVMQE LHDEAFRRID CLKCAHCCAV        60
     VGPRLTDTDI QRLGKALSMK PSAFEDTYLI RDEDGDLVFR EHPCPFLLAD NRCLLYDRRP       120
     KACREYPHTD DKHARGLLKI SLVNTRFCPI VALVFQGLEE RYG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page