(data stored in ACNUC7421 zone)

EMBL: CP002116.PE206

CP002116.PE206       Location/Qualifiers
FT   CDS             complement(211823..212923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0209"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="COGs: COG2114 Adenylate cyclase family 3 (some
FT                   protein contain HAMP domain); InterPro IPR001054:IPR018370;
FT                   KEGG: amc:MADE_00483 adenylate cyclase; PFAM: adenylyl
FT                   cyclase class-3/4/guanylyl cyclase; SMART: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; SPTR: Adenylate cyclase; PFAM:
FT                   Adenylate and Guanylate cyclase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79366"
FT                   /db_xref="GOA:E1RA75"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA75"
FT                   /protein_id="ADK79366.1"
FT                   /translation="MEGTILIVSNLPIDTTKIRRYLAEHKIGDFDVVKVETEAAAEEIF
FT                   YGGGGVDCIVAQSEMTGTVALLKEMKQDEMFRHVPILLIIKGNETKLINEVYDSGFDAH
FT                   IVYTDIHCLPQRIRPLIVMNVMYRNMMKQVGDLHEKAISDFILLDLIKNYIPKTIWDIA
FT                   KTFAHEQKISIPEEELDLTIVFADIKGFTAMTQHMEPRQVVSILNTVFEVAAKHIYQNH
FT                   GDIDKYIGDAFFAVFTKAKEAVTAMTAMQDELEQINLQRKNQEHSPVEFRVGIHSGPII
FT                   RGNVGGHDRYDNTLIGDTVNTASRLEHIAPAGGIVISEETRTRIGITLPESCKSETELR
FT                   GRDSKITVYNAFSFLRSKLLAPQDKS"
     MEGTILIVSN LPIDTTKIRR YLAEHKIGDF DVVKVETEAA AEEIFYGGGG VDCIVAQSEM        60
     TGTVALLKEM KQDEMFRHVP ILLIIKGNET KLINEVYDSG FDAHIVYTDI HCLPQRIRPL       120
     IVMNVMYRNM MKQVGDLHEK AISDFILLDL IKNYIPKTIW DIAKTFAHEQ KISIPEEELD       180
     LTIVFADIKG FTAMTQHMEP RQVVSILNTV FEVAAKHIYQ NHGDIDKYIG DAFFAVFTKA       240
     KEAVTAMTAM QDELEQINLQ RKNQEHSPVE FRVGIHSGPI IRGNVGGHDR YDNTLIGDTV       300
     NTASRLEHIA PAGGIVISEE TRTRIGITLP ESCKSETELR GRDSKITVYN AFSFLRSKLL       360
     APQDKS                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page