(data stored in ACNUC7421 zone)

EMBL: CP002116.PE207

CP002116.PE207       Location/Qualifiers
FT   CDS             212996..213250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slt:Slit_1635 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79367"
FT                   /db_xref="GOA:E1RA76"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA76"
FT                   /protein_id="ADK79367.1"
FT                   /translation="MKRFILSLLIGALAGLVAGYFVFGKSGVTGSYVPVDQLFGGAKNA
FT                   LVSLSRAVTGLDHIRNEILLSGLFGASMGVHIGSIGRRR"
     MKRFILSLLI GALAGLVAGY FVFGKSGVTG SYVPVDQLFG GAKNALVSLS RAVTGLDHIR        60
     NEILLSGLFG ASMGVHIGSI GRRR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page