(data stored in ACNUC7421 zone)

EMBL: CP002116.PE208

CP002116.PE208       Location/Qualifiers
FT   CDS             213253..215031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0211"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587:IPR000994; KEGG: bth:BT_2743 putative
FT                   aminopeptidase; PFAM: peptidase M24; creatinase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79368"
FT                   /db_xref="GOA:E1RA77"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA77"
FT                   /protein_id="ADK79368.1"
FT                   /translation="MNNPVLPRLSALRREMEERALQAVVFFGTDPHQSEYAAPRWKDRL
FT                   WMSGFSGSAGTVVVTETEAALWTDSRYWLQATDQLDGSGIVLMADGDPSVPSLPDWLIS
FT                   KLSPGARVGVDYQTLSVASERRLSHILGTKGIALVSFESLLNDLWTDRPARPCEPLYAI
FT                   DLHYVGKSRDQKITLLRDAAKNVGADAMFLSALDEIAWLLNLRGNDIAYNPFFFSYLLI
FT                   RETDTLLFADIHAVSKELEELLAEEHITLKAYEAVGEMLREFEGTLFVDPASFSMALKG
FT                   ALSPGVRIVEEQSPVAALKARKEAVEVEGFRHALRKDGVALVRFWMRLERMLERGDGDE
FT                   ISVASLLYEERSRMPGFVGESFAPIVGFAEHGAVVHYSATKESAIPVTGRGLLLIDSGG
FT                   QYIEGTTDITRVFAVGKATEEEIFDYTTVLKAHISLATAIFPIGTVGTRLDAMARRPMW
FT                   EAGLNYGHGTGHGVGAFLGVHEGPQSISTKLLPVPIEPGMVCSNEPGVYREGKHGIRIE
FT                   NLILAVEKFNTPFGRFLGFETLTPFPFECKLIDVSLLTEGERQWVDRYHAWVFELLSSE
FT                   LNPQERSFLAAKTGVV"
     MNNPVLPRLS ALRREMEERA LQAVVFFGTD PHQSEYAAPR WKDRLWMSGF SGSAGTVVVT        60
     ETEAALWTDS RYWLQATDQL DGSGIVLMAD GDPSVPSLPD WLISKLSPGA RVGVDYQTLS       120
     VASERRLSHI LGTKGIALVS FESLLNDLWT DRPARPCEPL YAIDLHYVGK SRDQKITLLR       180
     DAAKNVGADA MFLSALDEIA WLLNLRGNDI AYNPFFFSYL LIRETDTLLF ADIHAVSKEL       240
     EELLAEEHIT LKAYEAVGEM LREFEGTLFV DPASFSMALK GALSPGVRIV EEQSPVAALK       300
     ARKEAVEVEG FRHALRKDGV ALVRFWMRLE RMLERGDGDE ISVASLLYEE RSRMPGFVGE       360
     SFAPIVGFAE HGAVVHYSAT KESAIPVTGR GLLLIDSGGQ YIEGTTDITR VFAVGKATEE       420
     EIFDYTTVLK AHISLATAIF PIGTVGTRLD AMARRPMWEA GLNYGHGTGH GVGAFLGVHE       480
     GPQSISTKLL PVPIEPGMVC SNEPGVYREG KHGIRIENLI LAVEKFNTPF GRFLGFETLT       540
     PFPFECKLID VSLLTEGERQ WVDRYHAWVF ELLSSELNPQ ERSFLAAKTG VV               592
//

If you have problems or comments...

PBIL Back to PBIL home page