(data stored in ACNUC7421 zone)

EMBL: CP002116.PE209

CP002116.PE209       Location/Qualifiers
FT   CDS             215034..215990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0212"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: kol:Kole_0844 cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein; SPTR:
FT                   Cation diffusion facilitator family transporter; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   Cation efflux family; TIGRFAM: cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79369"
FT                   /db_xref="GOA:E1RA78"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA78"
FT                   /protein_id="ADK79369.1"
FT                   /translation="MKEKGRKPSDFRIRMIRRASWVGILGNGLLSALKVTVGFFSGSLA
FT                   LVGDGIDSATDVVTSFVSLLTAGIVERPPDNEHPYGHARAETVATKILGFLIFFAGAQL
FT                   ALSTLRSLFSGVSRPLPEFPAAMVALVSVVGKSLLAFYKLRVGRTIDSPMLIADARNMT
FT                   GDVVISLGVFAGIGATLLSGIAFLDSIIALLVSLWIMKVAFSIFMEAGDELMDGLDNPD
FT                   LYRRLFDAVGTVKGAGNPHKARIRKLGNACIVDLDIEVDGAISVAEGHEIAREVERAIH
FT                   LQLKNVYDVQVHVEPLGNLEKKERFGLSRQSLETSGK"
     MKEKGRKPSD FRIRMIRRAS WVGILGNGLL SALKVTVGFF SGSLALVGDG IDSATDVVTS        60
     FVSLLTAGIV ERPPDNEHPY GHARAETVAT KILGFLIFFA GAQLALSTLR SLFSGVSRPL       120
     PEFPAAMVAL VSVVGKSLLA FYKLRVGRTI DSPMLIADAR NMTGDVVISL GVFAGIGATL       180
     LSGIAFLDSI IALLVSLWIM KVAFSIFMEA GDELMDGLDN PDLYRRLFDA VGTVKGAGNP       240
     HKARIRKLGN ACIVDLDIEV DGAISVAEGH EIAREVERAI HLQLKNVYDV QVHVEPLGNL       300
     EKKERFGLSR QSLETSGK                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page