(data stored in ACNUC7421 zone)

EMBL: CP002116.PE21

CP002116.PE21        Location/Qualifiers
FT   CDS             17596..18168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_2057 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79181"
FT                   /db_xref="GOA:E1R6P9"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P9"
FT                   /protein_id="ADK79181.1"
FT                   /translation="MKIRAGQLLLERPGLIFILFLGMGINLVGYYIVYWLELPLFLDSM
FT                   GTFLAAAVLGPWLGAACGFFSNLLIGLIDNPVMIPFALVNIVIGIIVGLFSLHFRFRSL
FT                   FVVIIGALVSALVSSLLGTVITVFVFGGVSGGVIDAFVAGMATSGREIFSSTFLVRLPV
FT                   NIGDKLFSAFLIWIFLLLFPERWKGYA"
     MKIRAGQLLL ERPGLIFILF LGMGINLVGY YIVYWLELPL FLDSMGTFLA AAVLGPWLGA        60
     ACGFFSNLLI GLIDNPVMIP FALVNIVIGI IVGLFSLHFR FRSLFVVIIG ALVSALVSSL       120
     LGTVITVFVF GGVSGGVIDA FVAGMATSGR EIFSSTFLVR LPVNIGDKLF SAFLIWIFLL       180
     LFPERWKGYA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page