(data stored in ACNUC7421 zone)

EMBL: CP002116.PE211

CP002116.PE211       Location/Qualifiers
FT   CDS             complement(217731..218495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0214"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036:IPR018356; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79371"
FT                   /db_xref="GOA:E1RA80"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA80"
FT                   /protein_id="ADK79371.1"
FT                   /translation="MNSSLRRGHLIDYLKNSRSATIQELAEHFEVSHMTIRRDLEKLIE
FT                   NQPIKIIHGGVIYQESGQGDHYSIIKARTHMLEAKKKIAKKAASLVEADDIIIIDAGST
FT                   GELIAEFLPKDRPITIICYALNIATVVSKRENCTLILTGGCYHGSSMVFESEEGLSLIK
FT                   RNRAKKAFVTASGISAKLGITCSNFFESTTKRIALKSSLTTILVADSSKFGEIQNGYFS
FT                   DLSDFDIIITDEGLPPEFRKEIARLEKTLYIE"
     MNSSLRRGHL IDYLKNSRSA TIQELAEHFE VSHMTIRRDL EKLIENQPIK IIHGGVIYQE        60
     SGQGDHYSII KARTHMLEAK KKIAKKAASL VEADDIIIID AGSTGELIAE FLPKDRPITI       120
     ICYALNIATV VSKRENCTLI LTGGCYHGSS MVFESEEGLS LIKRNRAKKA FVTASGISAK       180
     LGITCSNFFE STTKRIALKS SLTTILVADS SKFGEIQNGY FSDLSDFDII ITDEGLPPEF       240
     RKEIARLEKT LYIE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page