(data stored in ACNUC7421 zone)

EMBL: CP002116.PE212

CP002116.PE212       Location/Qualifiers
FT   CDS             218708..219700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0215"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; KEGG: cro:ROD_24811 ABC transporter,
FT                   substrate-binding protein; SPTR: ABC transporter,
FT                   substrate-binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79372"
FT                   /db_xref="GOA:E1RA81"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA81"
FT                   /protein_id="ADK79372.1"
FT                   /translation="MKKIVLIIVIVLVLLPLHLFAGGQKDAADANKYEIVTVVKITGIP
FT                   WFNRLEEGVDAAAKDLDVNAYQIGPSDADPAQQVKMVEDLISKGVDAICITPNDATALE
FT                   PVFQKAKEKGILILTHESPDQAGKDVDIELIDNVEFGRHTWDMLVKYMGDKGQYAIFVG
FT                   GLTVPLHNLWADEGLKYAKEHYPGLELVTSRIPCGEDQELAKQKTLELLKTYPDLKGII
FT                   GFGSLGPPGAAQALKEKGLAGKVAVVGNVIPGHAAPYLKDGSMSHGVLWDPKDAGYSLT
FT                   YVAKYLLDGGSLADLKEIPGIGAVVVDGDVIKVDAMADITKENVDSFGF"
     MKKIVLIIVI VLVLLPLHLF AGGQKDAADA NKYEIVTVVK ITGIPWFNRL EEGVDAAAKD        60
     LDVNAYQIGP SDADPAQQVK MVEDLISKGV DAICITPNDA TALEPVFQKA KEKGILILTH       120
     ESPDQAGKDV DIELIDNVEF GRHTWDMLVK YMGDKGQYAI FVGGLTVPLH NLWADEGLKY       180
     AKEHYPGLEL VTSRIPCGED QELAKQKTLE LLKTYPDLKG IIGFGSLGPP GAAQALKEKG       240
     LAGKVAVVGN VIPGHAAPYL KDGSMSHGVL WDPKDAGYSL TYVAKYLLDG GSLADLKEIP       300
     GIGAVVVDGD VIKVDAMADI TKENVDSFGF                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page