(data stored in ACNUC7421 zone)

EMBL: CP002116.PE213

CP002116.PE213       Location/Qualifiers
FT   CDS             219776..221278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   rle:pRL80086 putative ATP-binding component of ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter ATP binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79373"
FT                   /db_xref="GOA:E1RA82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA82"
FT                   /protein_id="ADK79373.1"
FT                   /translation="METLFLSMKQITKVYAGVRALDGVDFSIARGEIHCLAGTNGSGKS
FT                   TLVKIISGVVAPEAGAEIIMDGELLDQHTSRTAISHGVEVIYQDLSLFPNLTVAENIAV
FT                   SSNIAQRRYLMDWKRAETTATKAMNRIGISIPLDARVGELSMADQQLVAICRALTGDVR
FT                   LLIMDEPTTALTKKEIDALLRVVIELKNKGIASLFISHKLNEVMQIAERVTVLRDGTLI
FT                   GTYDGKTIDDKKLEFLMTGETSVYEPYHVSPDRNGKPILRLENFSRNHSFCNVSLEVYS
FT                   GEIVGITGLLGSGRSELALSIFGFHPADSGRMEMNGEEVSIDSVETAKHHGIAYVPEDR
FT                   IHQGLVMDQSVSRNLVATVIDRLQGKTSLIDTKKLHETVAYWVETLKIKVPSLDAPVKT
FT                   LSGGNQQRIVLGKWIATEPRLFILDNPTVGIDVSAKSSIHKTIKKLAREGMGVIIISDE
FT                   ISEVLNNCSRILVMHKGRIIGSFDTTEASEEEIQAFIESQSI"
     METLFLSMKQ ITKVYAGVRA LDGVDFSIAR GEIHCLAGTN GSGKSTLVKI ISGVVAPEAG        60
     AEIIMDGELL DQHTSRTAIS HGVEVIYQDL SLFPNLTVAE NIAVSSNIAQ RRYLMDWKRA       120
     ETTATKAMNR IGISIPLDAR VGELSMADQQ LVAICRALTG DVRLLIMDEP TTALTKKEID       180
     ALLRVVIELK NKGIASLFIS HKLNEVMQIA ERVTVLRDGT LIGTYDGKTI DDKKLEFLMT       240
     GETSVYEPYH VSPDRNGKPI LRLENFSRNH SFCNVSLEVY SGEIVGITGL LGSGRSELAL       300
     SIFGFHPADS GRMEMNGEEV SIDSVETAKH HGIAYVPEDR IHQGLVMDQS VSRNLVATVI       360
     DRLQGKTSLI DTKKLHETVA YWVETLKIKV PSLDAPVKTL SGGNQQRIVL GKWIATEPRL       420
     FILDNPTVGI DVSAKSSIHK TIKKLAREGM GVIIISDEIS EVLNNCSRIL VMHKGRIIGS       480
     FDTTEASEEE IQAFIESQSI                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page