(data stored in ACNUC7421 zone)

EMBL: CP002116.PE214

CP002116.PE214       Location/Qualifiers
FT   CDS             221290..222297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0217"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: cro:ROD_24831 putative ABC transporter
FT                   membrane protein; PFAM: inner-membrane translocator; SPTR:
FT                   Ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems permease component 2; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79374"
FT                   /db_xref="GOA:E1RA83"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA83"
FT                   /protein_id="ADK79374.1"
FT                   /translation="MKRFMKTHEFHVLVVVLILSAAITAVNPNFLTLENGFDLLKSYSF
FT                   MGVLAIGILFVLISGGIDISFAATATVAEYVMAVVSIKLGGNMITSLLLATLVGLLLGA
FT                   FNGFLISKFKIAPIITTIATMNFYYGILTVITGGKWIYALPEWFRAFADIRVFTLVSRA
FT                   GTPYGLSVITLFWAVITVLAFFLLRYTMLGRGIYAIGGDIGSAERVGFPVRRLQIFVYS
FT                   FMGMMAGIAGVIQALLVQTVAPNSIVGKELDVIAAVVLGGASLSGGFGSVGGTLLGVFL
FT                   IAVVKNGMTLVKIPAVWYDVFIGAVILISVGFTSWQGKKGYHQAVIDIEKEEAA"
     MKRFMKTHEF HVLVVVLILS AAITAVNPNF LTLENGFDLL KSYSFMGVLA IGILFVLISG        60
     GIDISFAATA TVAEYVMAVV SIKLGGNMIT SLLLATLVGL LLGAFNGFLI SKFKIAPIIT       120
     TIATMNFYYG ILTVITGGKW IYALPEWFRA FADIRVFTLV SRAGTPYGLS VITLFWAVIT       180
     VLAFFLLRYT MLGRGIYAIG GDIGSAERVG FPVRRLQIFV YSFMGMMAGI AGVIQALLVQ       240
     TVAPNSIVGK ELDVIAAVVL GGASLSGGFG SVGGTLLGVF LIAVVKNGMT LVKIPAVWYD       300
     VFIGAVILIS VGFTSWQGKK GYHQAVIDIE KEEAA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page