(data stored in ACNUC7421 zone)

EMBL: CP002116.PE215

CP002116.PE215       Location/Qualifiers
FT   CDS             222297..223274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0218"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: spe:Spro_4696 monosaccharide-transporting
FT                   ATPase; PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79375"
FT                   /db_xref="GOA:E1RA84"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA84"
FT                   /protein_id="ADK79375.1"
FT                   /translation="MKRKELRVLTIIMVLSFVFMTVLNPRDFLRAGNFQGMAFQLPELG
FT                   VLSLAMMIVMLTGGINLSIIATADLAGIVAAMILTIPKFGGVQAPGWLVMLALVGAIAA
FT                   ALLVGLLNGVLIAYIGVAPILTTLGTMTLINGITIVLTKGYVISGFPPAVRFIGNGMLL
FT                   GIPFPLLLFGLLAVVMAIFLNRTPTGFNIYMYGSNDVATHFYGGNNAGIILRTYLVSGL
FT                   LSGFAALIMISRFNSAKAGYGASYLLVTILAAVLGGVSSEGGFGRVSGLILSLVTLQII
FT                   SSGLNLLRVSSFMTIAIWGFVMILVMVVNYYSDKRRERLLRTQG"
     MKRKELRVLT IIMVLSFVFM TVLNPRDFLR AGNFQGMAFQ LPELGVLSLA MMIVMLTGGI        60
     NLSIIATADL AGIVAAMILT IPKFGGVQAP GWLVMLALVG AIAAALLVGL LNGVLIAYIG       120
     VAPILTTLGT MTLINGITIV LTKGYVISGF PPAVRFIGNG MLLGIPFPLL LFGLLAVVMA       180
     IFLNRTPTGF NIYMYGSNDV ATHFYGGNNA GIILRTYLVS GLLSGFAALI MISRFNSAKA       240
     GYGASYLLVT ILAAVLGGVS SEGGFGRVSG LILSLVTLQI ISSGLNLLRV SSFMTIAIWG       300
     FVMILVMVVN YYSDKRRERL LRTQG                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page