(data stored in ACNUC7421 zone)

EMBL: CP002116.PE216

CP002116.PE216       Location/Qualifiers
FT   CDS             223288..224763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0219"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: ttr:Tter_2252
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   FGGY family of carbohydrate kinases, N-terminal domain;
FT                   FGGY family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79376"
FT                   /db_xref="GOA:E1RA85"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA85"
FT                   /protein_id="ADK79376.1"
FT                   /translation="MSGKEIHCVGFDCGNSSIRTVLGHFDGTNIEVELIQQVPNGTVRV
FT                   EGYDYWDILHIFSQMQQGLKQAVAAAGGTVASAGISTWGIDFGLFGPSGQLLGNPLCYR
FT                   NELGGLGLGTLGEESRKKMFEQSGIQNHPMNSVYQFVGIRDHLPEYYRLAEKMMLTPDL
FT                   LNFLFTGSFNTETSIASTTQLMNMRSGRFDDSLFDIAGIKKGIMPPVVDHGTVRGMLRQ
FT                   DIADYLDIAPLPFVAVPSHDTAAAVVTVPSLEGPFAFISSGTWSLIGTELSAPLINDEV
FT                   YNCELANEGGACGTITLLKNSAGMHILQNVKNELEMRENRRFAWDEVVDLSLKAAAFLG
FT                   DEKIPLFDPNHPSLYNPDSMIQALQLLTGEKKLDNILAGIYASLACNYGAAICDIEKIT
FT                   GTEYPVIHIIGGGCRNDHLNQMTADISGKPVVAGPVEATSLGTIAVQLMHHVPGLGLTD
FT                   IRKIVSDSVQPLRFEPKVGRDRLYQRYEELLKP"
     MSGKEIHCVG FDCGNSSIRT VLGHFDGTNI EVELIQQVPN GTVRVEGYDY WDILHIFSQM        60
     QQGLKQAVAA AGGTVASAGI STWGIDFGLF GPSGQLLGNP LCYRNELGGL GLGTLGEESR       120
     KKMFEQSGIQ NHPMNSVYQF VGIRDHLPEY YRLAEKMMLT PDLLNFLFTG SFNTETSIAS       180
     TTQLMNMRSG RFDDSLFDIA GIKKGIMPPV VDHGTVRGML RQDIADYLDI APLPFVAVPS       240
     HDTAAAVVTV PSLEGPFAFI SSGTWSLIGT ELSAPLINDE VYNCELANEG GACGTITLLK       300
     NSAGMHILQN VKNELEMREN RRFAWDEVVD LSLKAAAFLG DEKIPLFDPN HPSLYNPDSM       360
     IQALQLLTGE KKLDNILAGI YASLACNYGA AICDIEKITG TEYPVIHIIG GGCRNDHLNQ       420
     MTADISGKPV VAGPVEATSL GTIAVQLMHH VPGLGLTDIR KIVSDSVQPL RFEPKVGRDR       480
     LYQRYEELLK P                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page