(data stored in ACNUC7421 zone)

EMBL: CP002116.PE218

CP002116.PE218       Location/Qualifiers
FT   CDS             complement(225069..225572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0221"
FT                   /product="DOMON domain protein"
FT                   /note="InterPro IPR005018:IPR013050; KEGG: ton:TON_0876
FT                   DOMON; PFAM: DOMON domain protein; SMART: DOMON domain
FT                   protein; SPTR: DOMON; PFAM: DOMON domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79378"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA87"
FT                   /protein_id="ADK79378.1"
FT                   /translation="MKRVLFILFLAFLILTPLAAATESTREIAGVTVTWKAEGEYVLIT
FT                   MSAKTTGWIAVGIEPENKMKGADMYIGYVDDKGAVVLEDHYGHRTFSHKSDVALGGSSD
FT                   VEIIQGTESGGETSITFRIPKNSRDVYDKLLEEGKEYTVITAWGEKDNLTARHKGRGSG
FT                   SLPL"
     MKRVLFILFL AFLILTPLAA ATESTREIAG VTVTWKAEGE YVLITMSAKT TGWIAVGIEP        60
     ENKMKGADMY IGYVDDKGAV VLEDHYGHRT FSHKSDVALG GSSDVEIIQG TESGGETSIT       120
     FRIPKNSRDV YDKLLEEGKE YTVITAWGEK DNLTARHKGR GSGSLPL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page