(data stored in ACNUC7421 zone)

EMBL: CP002116.PE219

CP002116.PE219       Location/Qualifiers
FT   CDS             complement(225742..228162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0222"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR010098:IPR004184:IPR001150; KEGG: str:Sterm_1074
FT                   pyruvate formate-lyase; PFAM: pyruvate formate-lyase PFL;
FT                   formate C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: pyruvate formate-lyase; PFAM: Glycine
FT                   radical; Pyruvate formate lyase; TIGRFAM: pyruvate
FT                   formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79379"
FT                   /db_xref="GOA:E1RA88"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA88"
FT                   /protein_id="ADK79379.1"
FT                   /translation="MNKRIAALRERLFEKIPEICPERAVLFTESMKQSEGQPIAKRRAQ
FT                   ALYEVLDKMTIFVRDGELIVGNQASTTRGAPAFPEYSVDWIIKEFNGDPYHFAERPCDR
FT                   FTYSERTKEQLLATIDYWKGKTLFENVWSQLPEEARVAWEINAIDDTWCAAAGLGNVLP
FT                   DHQMVLEQGLERIIERAEKRIADLDLTEPGTISQYWFLQAVVTANKAVINFAGRFADLL
FT                   LDLAEKERDQVRKKELLTMSENCRQVPAKPAQSFWQAIQAVWFIQLILQIETNGHAISL
FT                   GRFDQYLWPYFQRDIQRGVLTREKALELVESFFIKANEINKLRSWADSEYFPGYHLAEN
FT                   LAIGGQTADGRDAVNELTYTILDATADLKLTKPSVSLKWFEGTSDEFMDKALSVVEAHK
FT                   GGQPALYNDLAVMRILDNMGVKKEDQYGWAPVGCIEATVPGKWDFAAKGSWLNVGKIFE
FT                   MTLNNGKDPATGITLMKGEGDLTAFSDTHAIMEACKKQLFYYMRLQVIVEHISDEMHIL
FT                   HDQNAFRSSLVHDCIERGKSLIEGGAVYTADGGPAAGHISVGDSLAAIEYAVFEKGILS
FT                   LSQLQHALSTNFEDQTTSPSGEEIRQLMIHKAPKFGNDDDAADKWTVEINEFLGSTYQK
FT                   AFKSSRYGKGPIPATFALSQSSVTGNVAFGKSVGALPCGRKAGEPVNNGVSPANGSERN
FT                   GPTAVINSEAKLPSIWFQKGSIFNMRLTPQTLSTAEGRKRTLALVKTHFKNYQYHIQFN
FT                   VLDDATLEEAQKKPEEYRDLMVRISGYSAFFTPLNKELQNDVIARMKFNMADK"
     MNKRIAALRE RLFEKIPEIC PERAVLFTES MKQSEGQPIA KRRAQALYEV LDKMTIFVRD        60
     GELIVGNQAS TTRGAPAFPE YSVDWIIKEF NGDPYHFAER PCDRFTYSER TKEQLLATID       120
     YWKGKTLFEN VWSQLPEEAR VAWEINAIDD TWCAAAGLGN VLPDHQMVLE QGLERIIERA       180
     EKRIADLDLT EPGTISQYWF LQAVVTANKA VINFAGRFAD LLLDLAEKER DQVRKKELLT       240
     MSENCRQVPA KPAQSFWQAI QAVWFIQLIL QIETNGHAIS LGRFDQYLWP YFQRDIQRGV       300
     LTREKALELV ESFFIKANEI NKLRSWADSE YFPGYHLAEN LAIGGQTADG RDAVNELTYT       360
     ILDATADLKL TKPSVSLKWF EGTSDEFMDK ALSVVEAHKG GQPALYNDLA VMRILDNMGV       420
     KKEDQYGWAP VGCIEATVPG KWDFAAKGSW LNVGKIFEMT LNNGKDPATG ITLMKGEGDL       480
     TAFSDTHAIM EACKKQLFYY MRLQVIVEHI SDEMHILHDQ NAFRSSLVHD CIERGKSLIE       540
     GGAVYTADGG PAAGHISVGD SLAAIEYAVF EKGILSLSQL QHALSTNFED QTTSPSGEEI       600
     RQLMIHKAPK FGNDDDAADK WTVEINEFLG STYQKAFKSS RYGKGPIPAT FALSQSSVTG       660
     NVAFGKSVGA LPCGRKAGEP VNNGVSPANG SERNGPTAVI NSEAKLPSIW FQKGSIFNMR       720
     LTPQTLSTAE GRKRTLALVK THFKNYQYHI QFNVLDDATL EEAQKKPEEY RDLMVRISGY       780
     SAFFTPLNKE LQNDVIARMK FNMADK                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page