(data stored in ACNUC7421 zone)

EMBL: CP002116.PE22

CP002116.PE22        Location/Qualifiers
FT   CDS             18168..19775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0022"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR001638:IPR003594:IPR011495:IPR005467; KEGG:
FT                   rci:LRC120 signal transduction histidine kinase; PFAM:
FT                   histidine kinase dimerisation/phosphoacceptor; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; extracellular solute-binding protein
FT                   family 3; SPTR: Multi-sensor signal transduction
FT                   multi-kinase; PFAM: Histidine kinase; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79182"
FT                   /db_xref="GOA:E1R6Q0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q0"
FT                   /protein_id="ADK79182.1"
FT                   /translation="MRNFFAVLFFSLVICVPEIFCLQNLTVVGGANGNVPYEYLDDKGR
FT                   PRGILVDVWDLWSKESGVEVSYLLVDNFKDVMDLAGNDASGPIVLAHDRIPGFSDDAGR
FT                   FEHGEVYYEVQPSIFYHKRISGIIRIEEMAGYVVGVAADSGIEAPLAEAYPSLVIRSYD
FT                   SRQALLAAVLSHQIHLFVGYPPSMIHQIGITGNARAFRSGKALSFSMPFAPVLVKGPKE
FT                   LLEDIQEGFSSMSPFARNLTIHRQTGFFRGWSIRWPLIAAVGLVLMVGLLFSLFWFWKL
FT                   QLDKRIRQATDALVEQRRQLEISRDALAHALREKEILLKEIHHRVKNNLQIISSLANLI
FT                   RNTGGTTDEGRDRFAELQSRVVSMAKVHEVIYTNEQFEQVPLRDLIKEISELLISSIGM
FT                   GLAIRLSVKCDNLAINVGDATAFSLIIHEAVANAIKHAFAPGRNNVLEILVREINNTVV
FT                   LCIKDNGAGFPAELDFDGKNHLGLFMIKQLATQLRGEFVLKNCGYEGSGAQITVEFPLP
FT                   EARFVGLPEENNRDYLRR"
     MRNFFAVLFF SLVICVPEIF CLQNLTVVGG ANGNVPYEYL DDKGRPRGIL VDVWDLWSKE        60
     SGVEVSYLLV DNFKDVMDLA GNDASGPIVL AHDRIPGFSD DAGRFEHGEV YYEVQPSIFY       120
     HKRISGIIRI EEMAGYVVGV AADSGIEAPL AEAYPSLVIR SYDSRQALLA AVLSHQIHLF       180
     VGYPPSMIHQ IGITGNARAF RSGKALSFSM PFAPVLVKGP KELLEDIQEG FSSMSPFARN       240
     LTIHRQTGFF RGWSIRWPLI AAVGLVLMVG LLFSLFWFWK LQLDKRIRQA TDALVEQRRQ       300
     LEISRDALAH ALREKEILLK EIHHRVKNNL QIISSLANLI RNTGGTTDEG RDRFAELQSR       360
     VVSMAKVHEV IYTNEQFEQV PLRDLIKEIS ELLISSIGMG LAIRLSVKCD NLAINVGDAT       420
     AFSLIIHEAV ANAIKHAFAP GRNNVLEILV REINNTVVLC IKDNGAGFPA ELDFDGKNHL       480
     GLFMIKQLAT QLRGEFVLKN CGYEGSGAQI TVEFPLPEAR FVGLPEENNR DYLRR            535
//

If you have problems or comments...

PBIL Back to PBIL home page