(data stored in ACNUC7421 zone)

EMBL: CP002116.PE220

CP002116.PE220       Location/Qualifiers
FT   CDS             complement(228238..229017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0223"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR014036; KEGG:
FT                   cbt:CLH_0701 deoxyribose operon repressor; PFAM: regulatory
FT                   protein DeoR; SMART: regulatory protein DeoR; SPTR:
FT                   Transcriptional regulator, DeoR family; PFAM: Bacterial
FT                   regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79380"
FT                   /db_xref="GOA:E1RA89"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA89"
FT                   /protein_id="ADK79380.1"
FT                   /translation="MGNKEKRLDALKKMIQLERSMKISEISDRLHVSPMTTRRDIEILA
FT                   QDGTVKVLHGVVVSNSGGMAGGLSDYMLAVAETRNIDEKKAIARHALNFVEEDDIIFID
FT                   AGSTTETFASMLPPDIRLTVVCYSINIFLAVASHKNIEVLLTGGHYSRKTTILELSQTS
FT                   PVLQHNRTRKAFISASGYHQRLGVTCAHQSECITKKAAMNNTAEAFLLMDSSKFDVVHS
FT                   CHFADIEQFSRIFTNESIPTEYHRLLKEKGITVDYVR"
     MGNKEKRLDA LKKMIQLERS MKISEISDRL HVSPMTTRRD IEILAQDGTV KVLHGVVVSN        60
     SGGMAGGLSD YMLAVAETRN IDEKKAIARH ALNFVEEDDI IFIDAGSTTE TFASMLPPDI       120
     RLTVVCYSIN IFLAVASHKN IEVLLTGGHY SRKTTILELS QTSPVLQHNR TRKAFISASG       180
     YHQRLGVTCA HQSECITKKA AMNNTAEAFL LMDSSKFDVV HSCHFADIEQ FSRIFTNESI       240
     PTEYHRLLKE KGITVDYVR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page