(data stored in ACNUC7421 zone)

EMBL: CP002116.PE221

CP002116.PE221       Location/Qualifiers
FT   CDS             229146..229820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0224"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   hor:Hore_18470 L-fuculose phosphate aldolase; PFAM: class
FT                   II aldolase/adducin family protein; SPTR: L-fuculose
FT                   phosphate aldolase; PFAM: Class II Aldolase and Adducin
FT                   N-terminal domain; TIGRFAM: L-ribulose-5-phosphate
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79381"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA90"
FT                   /protein_id="ADK79381.1"
FT                   /translation="MGRVKQELKELIVSTGVEMIKTGITVGTWGNISYRDPETDYMYIS
FT                   PSGMDYMKVKTDHVVVMDLDLNIIEGEAEPSIEKHMHVAVYKARPDAHAVIHTHPTFST
FT                   VFGVAGLPLPAVSEDFVQIVGEEIAIASPYALPGTPELGEVAVKGLGKNGAVLLPGHGA
FT                   LIAAANMPMALKISTVLEKNAQIYLYAKLLGNGIRLFSREEIDAMQNFAKNHYGKKNQE
FT                   LV"
     MGRVKQELKE LIVSTGVEMI KTGITVGTWG NISYRDPETD YMYISPSGMD YMKVKTDHVV        60
     VMDLDLNIIE GEAEPSIEKH MHVAVYKARP DAHAVIHTHP TFSTVFGVAG LPLPAVSEDF       120
     VQIVGEEIAI ASPYALPGTP ELGEVAVKGL GKNGAVLLPG HGALIAAANM PMALKISTVL       180
     EKNAQIYLYA KLLGNGIRLF SREEIDAMQN FAKNHYGKKN QELV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page