(data stored in ACNUC7421 zone)

EMBL: CP002116.PE222

CP002116.PE222       Location/Qualifiers
FT   CDS             229964..230998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0225"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: gka:GK2115 transcriptional
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family;
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79382"
FT                   /db_xref="GOA:E1RA91"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA91"
FT                   /protein_id="ADK79382.1"
FT                   /translation="MSRYTITEFAKICGTSPATVSRVLNNPELVAAPLRKHVEEKMKEL
FT                   GYKPNPFASKLSSKSSWGLALFVFDILNPFFALIVRRISHLAMEQGIPLTICDTENNAD
FT                   KERIYLDYLLDNKIAGVIFAEGISLPTIERAQHYTETVLIDRHSQEGFVSEVSSDNYTG
FT                   GRQATEYLLQLNHQRIAFISGPENWPSVEDRFHGYRDALDAYGVPFHPELVYQGDLRYE
FT                   SGISAIEYFLTLPEWPTAIFSANDQMAYGAMSKARHLNIAIPEDISLVGFDDIPFHNFF
FT                   QANLTTVKQDIPALCENAFSILIGKVNNGSQGGIEKRVVVPTTLKIGDTCRKLVGSVKR
FT                   PAIR"
     MSRYTITEFA KICGTSPATV SRVLNNPELV AAPLRKHVEE KMKELGYKPN PFASKLSSKS        60
     SWGLALFVFD ILNPFFALIV RRISHLAMEQ GIPLTICDTE NNADKERIYL DYLLDNKIAG       120
     VIFAEGISLP TIERAQHYTE TVLIDRHSQE GFVSEVSSDN YTGGRQATEY LLQLNHQRIA       180
     FISGPENWPS VEDRFHGYRD ALDAYGVPFH PELVYQGDLR YESGISAIEY FLTLPEWPTA       240
     IFSANDQMAY GAMSKARHLN IAIPEDISLV GFDDIPFHNF FQANLTTVKQ DIPALCENAF       300
     SILIGKVNNG SQGGIEKRVV VPTTLKIGDT CRKLVGSVKR PAIR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page