(data stored in ACNUC7421 zone)

EMBL: CP002116.PE223

CP002116.PE223       Location/Qualifiers
FT   CDS             231015..231932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0226"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR007197:IPR001450:IPR017896:IPR
FT                   011352:IPR017900:IPR005829:IPR001989; KEGG: rpc:RPC_1176
FT                   glycyl-radical activating protein; PFAM: Radical SAM domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PRIAM: [Formate-C-acetyltransferase]-activating
FT                   enzyme; SPTR: Glycyl-radical enzyme activating; TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: glycyl-radical enzyme
FT                   activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79383"
FT                   /db_xref="GOA:E1RA92"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA92"
FT                   /protein_id="ADK79383.1"
FT                   /translation="MAENLTIFELERYALEDGPGIRTVVFFKGCNLHCLWCQNPESQQR
FT                   RPQVLYYRKQCVGCGKCIETCPAGAIDTASDLGFVTIHDRCTLCASCVDACFYNARRIA
FT                   GEVRSSEDIMREIMKDQSFYENSGGGVTFSGGEPLLQIEGLVDLASRCRSEGIHTALET
FT                   AGSVPWDRFERIFPYMNLIYFDVKHIDPLVHERVVGAPNGVILNNLIRLSREFEPVIVR
FT                   IPVIPGVNDSPEVIGDICSFLSTRTRVRKVELLPFHRLGSGKYAALGREDSMEGVPSLD
FT                   KAACLPLAGLGKRFGLDITVGAGH"
     MAENLTIFEL ERYALEDGPG IRTVVFFKGC NLHCLWCQNP ESQQRRPQVL YYRKQCVGCG        60
     KCIETCPAGA IDTASDLGFV TIHDRCTLCA SCVDACFYNA RRIAGEVRSS EDIMREIMKD       120
     QSFYENSGGG VTFSGGEPLL QIEGLVDLAS RCRSEGIHTA LETAGSVPWD RFERIFPYMN       180
     LIYFDVKHID PLVHERVVGA PNGVILNNLI RLSREFEPVI VRIPVIPGVN DSPEVIGDIC       240
     SFLSTRTRVR KVELLPFHRL GSGKYAALGR EDSMEGVPSL DKAACLPLAG LGKRFGLDIT       300
     VGAGH                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page